Mini Shell
Mini Shell
| Direktori : /usr/local/go/pkg/freebsd_amd64/encoding/ |
| Current File : //usr/local/go/pkg/freebsd_amd64/encoding/xml.a |
!<arch>
__.PKGDEF 0 0 0 644 22168 `
go object freebsd amd64 go1.17.6 X:
build id "0cJ01ROgy-BU6pTFjQGJ/IwEVjKtGOZstHQdlD8A9"
$$B
i&#$GOROOT/src/encoding/xml/marshal.go'<?xml version="1.0" encoding="UTF-8"?>
v
MarshalXMLeEncoderstart StartElementMarshalXMLAttrnameNameAttrprefixindentpprinterIndentencEncode
EncodeElement EncodeTokentTokenFlushesc:esc:esc:~r0Writerbufio$GOROOT/src/bufio/bufio.gobwio~r1 NewWriterencoderTypereflectErrorUnsupportedTypeErrorxml: unsupported type: String$GOROOT/src/reflect/type.go $GOROOT/src/encoding/xml/read.godataUnmarshalErroresc: UnmarshalXMLdDecoderUnmarshalXMLAttrattr$$GOROOT/src/encoding/xml/typeinfo.goStructField1Tag1Field2Tag2 TagPathErrorSprintffmt$GOROOT/src/fmt/print.goformata;%s field %q with tag %q conflicts with field %q with tag %q $GOROOT/src/encoding/xml/xml.goMsgLine SyntaxErrorXML syntax error on line Itoastrconv$GOROOT/src/strconv/itoa.goi: SpaceLocalValueCopyEnd
EndElementesc:attrscCharDatamakeCopyCommentTargetInstProcInst DirectiveStrict AutoCloseEntity
CharsetReadercharsetinputReader DefaultSpacer
ByteReader TokenReaderbufBufferbytessavedstkstackfree needClosetoClose nextTokennextBytenserrlineoffsetunmarshalDepthDecode
DecodeElementunmarshalInterfaceval UnmarshalerunmarshalTextInterfaceTextUnmarshalerencoding
unmarshalAttr unmarshal
unmarshalPathtinfotypeInfosvparentsconsumedSkip translaten
isElementNameswitchToReaderpushkindpoppushEOFpopEOF pushElementpushNslocalurlok syntaxErrormsg
popElement autoCloseRawTokenrawTokenattrvalspacegetc InputOffset savedOffsetmustgetcungetctextquotecdatansnamesreadName~r2
.autotmp_3
.autotmp_4 errRawToken
escapeText
escapeNewline
EscapeTextsizewr
NewWriterSizebase FormatInt $GOROOT/src/reflect/value.gosafex$GOROOT/src/math/const.gob1seqdepth
indentedIn
putNewlineattrNS
attrPrefixprefixestagscreateAttrPrefixdeleteAttrPrefix
markPrefix popPrefix marshalValuefinfo fieldInfo
startTemplate marshalAttrmarshalInterface MarshalermarshalTextInterface
TextMarshaler
writeStartwriteEnd
marshalSimpletyp
marshalStructcachedWriteError writeIndent
depthDelta EscapeStringSizeReset AvailableBufferedWritenn WriteByte WriteRune WriteStringReadFrom$GOROOT/src/io/io.goAlign
FieldAlignMethod MethodByName NumMethodPkgPathKind
Implementsu AssignableTo
ConvertibleTo
ComparableBitsChanDir
IsVariadicElemField StructField FieldByIndexindex FieldByNameFieldByNameFuncmatchInKeyLenNumFieldNumInNumOutOutcommonrtypeuncommon uncommonTypeReadReadByte$GOROOT/src/bytes/buffer.goofflastReadreadOpBytesemptyCapTruncatetryGrowByReslicegrowGrowWriteToNextReadRune
UnreadRune
UnreadByte ReadBytesdelim readSlice
ReadStringesc: next $GOROOT/src/encoding/encoding.go
UnmarshalTextptrflagpointerAddrBoolrunesCanAddrCanSetCallin CallSlicecallopCloseComplexFloatIndexInt CanInterface Interface
InterfaceDataIsNilIsValidIsZeroMapIndexkeyMapKeysMapRangeMapIterOverflowComplex
OverflowFloat OverflowInt OverflowUintPointerRecvrecvnbSendsendselectedSetSetBoolSetBytessetRunes
SetComplexSetFloatSetIntSetLenSetCap SetMapIndexelemSetUint
SetPointer SetStringSlicejSlice3kTryRecvTrySendUint
UnsafeAddrassignTocontextdsttargetConvert
CanConvertf
ValueErrorreflect.Value.Complexreflect.Value.Floatreflect.Value.Intreflect.Value.CanInterfacevalueInterfacereflect.Value.IsNiloverflowFloat32 reflect.Value.OverflowComplexreflect.Value.OverflowFloatbitSizetruncreflect.Value.OverflowIntreflect.Value.OverflowUintreflect.Value.Uintreflect.Value.UnsafeAddr/reflect.Value.UnsafeAddr of unaddressable valuexmlnamefieldsidxxmlnsflags
fieldFlagsvalueshouldInitNilPointers MarshalTextFunc
IsExportedm kindNamesTag StructTagOffset Anonymousptrdatahashtflagalign
fieldAlignequalgcdatastrnameOff ptrToThistypeOfftextOffpointersexportedMethodsmethodhasNameptrTogcSlicebeginendpkgPathmcountxcountmoff_methodsromustBeexpectedmustBeExportedmustBeExportedSlowmustBeAssignablemustBeAssignableSlowitGettagLookupwhySafe
isExportedhasTag
readVarintmtypifntfnxml .inittask CopyTokenEscape
HTMLAutoClose
HTMLEntityHeaderMarshal
MarshalIndent
MarshalerAttr
NewDecoder
NewEncoderNewTokenDecoder UnmarshalUnmarshalerAttr(*Decoder).Decode(*Decoder).InputOffset(*Decoder).RawToken(*Encoder).Flush(*Encoder).Indent(*SyntaxError).Error(*TagPathError).Error (*UnsupportedTypeError).Error
CharData.Copy Comment.CopyDirective.Copy
ProcInst.CopyStartElement.CopyStartElement.EndUnmarshalError.Error Kind.StringMethod.IsExportedStructField.IsExported
StructTag.Get
Value.CanAddrValue.CanInterface Value.CanSet
Value.Complex Value.Float Value.IntValue.Interface Value.IsNil
Value.IsValid
Value.KindValue.OverflowComplexValue.OverflowFloatValue.OverflowIntValue.OverflowUint
Value.UintValue.UnsafeAddr flag.kindC
Z $N F L&@N* N N N \NC jNN
O,ZF0dHPN T K N NN
w<k0NoN T s F 8L&< @N* N N NNN NN
N N FT Q4 5 7N N N(N64 5 ;N N NN FXi H64 5 %N N N 씣 LN씣 T 8FT u,FTL&<N <FpL&<dHPN hFh$N F XN N NN m N NN N
NNN N N N @ B4N F 4FmZF/* ' C ' \ F4#5 N N FNFNF ,4NF N N;q N
N N Z g 75 N & N씣 # $N씣 N T Z N N6 AF(*4L&<N N: NN N Zh$-4 TZ hN N@ h NN
40dHPN T N
Do,N T N
N N N N N N :< HN
Zdu H ,5 N,5 N,5 N,5 0N,5 @N T
Z dN N\ MyN
z N N N
. N Z
`q
5 N 5 NTv
Z
`N N` IuN
N NT N
k N NT T& oN
k N N N ZH\Hm /J F04 i N.4$ 1 N 4 N ZHX i'D 4 kI7 kN T ZH \NH] ZH XN Nb m Nd N
k NT NN>*(N* L,-< $N- * *T*$ LN Nh N H(-8 $N- * *T* HN Nj N
N* N N LA4 **N FN4 *I*N * T LN Nl a N P0-@ $N- * *T* PN Nn F($N Np N
$N NT NV@HN,N N NN
N N, N N N N N N N N N Nk N N N N N N N NH N
Nk LL&< X67 N씣 NhLN씣& <dN씣 T N씣 N
` { @P5?
NNZ
Q N N//
D6# N씣 N `N씣 N씣 N N hy5 NNT!I LL&<N hL&<dTN | DdTN X xN \ h Lo,N X LdTN
h
D
H
HdX
<
LNM TN Nq
X
$
}H
l mt
D
(N m4
HNI4
h
TN U$
`k a L 8 0 ` 0N ( \<N X(N N \ `N N} `N N} XN*Y L P qh hNi hNi0 ` ( L MP D , 0N* Xk, L P ( yH ` N< NN@u! N> NN ND NN NF N NH NN NJ NN NN NN NP Nv Nx NA Nz NP0 N| N#x N~ ( N ?l N -( N N/ N NNN9$ N N
N N N O N N N N N N ( N N NX N NN N N N F,4N Nr N
Z<} { //$: -/* ' -I8 5 P(%(% N
F@<N Nt N!4V1!NV:NNF;4 *( PN F;4 *( D N! I;N F;,4 *(N N NN@NF;4 *(N 6>4 * 5 N" F> 4 * N NNDaV
N
R4 ( // : {%
?8F 5 *5+*N 0{> * ' 1J$*!
0F84 (N N, NN#4R4 (N B4i P
$ M F(4N N. N(mVNFf($
(N N NN Bf$
(N . = @
%- F N N N?A F*
<L$
,N& N NN Z6
, {y=
W
l=Y5
>5
}5
F6
@
,N N N}F < HNNF >*(*Y
*/ J *F0 .E
F$*(N* Nf
]VNF;,4 *( PN N NNN kN " NF N
N N N
N
N
N( N( N N( N N) N T (D)t 0N )t u) ) L)d L)HtN )`dTk, LN )t )<dHPN P) )pdHPN 4)\dTN )Tk,N `)hH PN N* N )h
D LN ) |N})` a )d N NN N y1 N N 2, N NN N NN N NN N" NNN N$ N N& N N( NN N, NN N. F N0 N N
N* N
N
NT-
| HNID E LNM` \N] XNYD*, dT N u8T$ ( \ ,NN TP8
$ N0 N2 N
N4 N6 l N8 5 N: N N< N N> N N@ NB N
*,
T/ vN N 0 0
N 4N14 NN0 -(4N$N0 N u 0N- N (N% N $N! N0 , N I 4 N Q8 N U 4N 1D N (N0%8 4N 1 N N0 1404N0 e08N04N 8@0hN04N N % N N ,N) N $N! N ) $N0! ,N0T0
*,
T3
0NNT3 |z
V* N N4 NTR4 LN*M PNQ$ LN M DNE DNEP
Q< $p
NN ,@
N ]@
A,D*,
0\ ,
LP8
$ L8
$ lT N u8T$
P@*,
X@
N* ]@ \NNuD \ (\ `NaD `NaDT4*4 $T4*4 LX44 N N 0 N N
N N
N:< N $ N N , N N N NP N N N N N N N N N N N" E N$ N5H N& 58 N( N* # N, D N. NK8 N0 N N2 NGdN
N
Nk N NT :
8 *4N T:
0 N N8;N'
N N ;
LL ]<\Q'4 ; ;ND; ;j;
LH Y;QK4 ; ;N^;`;Y; < #
LL]0/ $64 ;!;N
\씣; <N씣0 0M!0
+DA-4<4 "N"0
A -8<4 ]"NY", &*',< | 64 ;";N
\씣; <N씣0 0<
'
LD
U0/ $64 ;%;N
\씣; <N씣0 0M% 0
+8
A-,?4 q&N & 0
A -,?4 Q&N
Y&, &*',< t 64 ;&;N
\씣; <N씣0 0< )
L<M0/
$64 ;';N
\씣; <N씣0 0/E'4 (N("0"
-0A- AQ"0"
+0A- AU"0"
+0A-$AY"0"
+0A-$BY"0"
A -$BY-, &*',< l 64 ;(;N
\씣; <N씣0 0< *
L` {q;(4 ;
(;N6(; Y, &*',< x"0 <"
;TQ 4 ; (;NP;`;b'; V*
L$
,N& *
LX&i TF Y*N & ,
LD U0/ $64 ;*;N
\씣; <N씣0 0M)$00000{$
<TQ/4 ;*;NH; ;f*; Y
,N / ,
4 !+N{+<PQ+4 ;*;N@;;b*; EA-HGa;,5,N
,
$0 0$
;Ag-HG4 m+NN Y -
, &*',< t 64 ;+;N
\씣; <N씣0 0< -
LL ]<84 ; +;NF+; .
L@0Q 464 ; ,;N
\씣; <N씣0 0Z6
,N 6
Ld
8 0/ $64 ;4;N
\씣; <N씣0 0M3.0.
X 'Li
\Lj
.0.
6N Y 6
, &*',< 64 ;4;N
\씣; <N씣0 0< 6
L\
, 0/ $64 ;4;N
\씣; <N씣0 0M3.0
.
XL Y.0.
6N Y 6
, &*',< 64 ;4;N
\씣; <N씣0 0< 7
LT
$ 0 / $64 ;5;N
\씣; <N씣0 0M4/00000/&/
L854 015 0N Nf-
/
E
PdOK @ X @ <$
Y, &*',< 64 ;5;N
\씣; <N씣0 0< 7
LX
( 0
/ $64 ;5;N
\씣; <N씣0 0M5/00 00 0
0 /&/
L854 016 0N Nf-
/
E
PdOK @
X @
<$
Y, &*',< 64 ;5;N
\씣; <N씣0 0<
G
L@
Q0/
$64 ;E;N
\씣; <N씣0 0/EE4 FNF?0@
-4
A- WY@0@
+4
A-$W]@0 @
+4
A-(Wa@0
@
+4
A-(W a@0 @
A -(W
E@0 @
-4
A-,W YQ, &*',< p 64 ;F;N
\씣; <N씣0 0< H
LX {i;$4 0
G 0NN0 Y"H
, &*',< pA0 <{A
;LQ'4 ;
F;ND; ;ZF; Y=, &-8 4 =GNT
;EL LNML @NA0L @N A L DN*E,L DN;E8L LN M$L HN I0L8;0N; i4LL;0N; }(L8,;0N; L <N=@L L LNM<L @NAL< N YLX04N XLT4N 0Ld;dN $L DN
E<L< N YL <N=LL `N a0L X&YL dN;eDL DN EdL LN ML HN IL @N0AL <N=`LH,N uL LN;ML PN;QXL@ N ]DL TNU<LX4N @L PNQ Ld
8N 4L\
,N PLT
$N y4LX
(N xL LN ML D
$ i L8 ( , dL8
9 L8
$ ( LL4
5TLD
E LH
* I,LH
; I,LP
Q8LH
I8L@
ATL@
A4L@
A@LT itLD
EXLP
Q LL
M$L< N eL@ N uL HNIDL P
$ u(LD
$N i L @NAL @N
ApL XN YLH@00\N LD N e4LP N N #U N N N N N N N N N $ N N N N N N N N N N N + N N N N N N N N N N + N N N @ N N N?$ N N K N $ N N N
N N N N N N N N N N N N N N NN N N84 N N>P N N?4 N N N N N N N NN N NN N N N NN N NN N N N N N N N N N N N NN N N N N N N N NNN N NNNN N N N N N N N N E N L N NNN N NN N NN )N
B ) N k NT>k NN
Z 0 N N N l N
NTVl
)`LD pN N^ NN
< *4Tl
N N N N N 0\ m;D4# #NR$N TmD 0 \N NF q 0D{U=(+ F$ 5B@ A 8
T
+ T 0 DN NH NPYT
0 PN N N
# N N N o N N0 N N #0p ;D4# +NR,N T#oD 0 pN N F
N@N@N
N N N p N N N
N p N p N p N p N q N N T p' 0Hp4Nq } 0Hp4N0 } 0Hq4N }0 TN0U0 LNM 0 DN E0 DNE,0 HNI0 \N]0 DN0E 0 TN U0 LN0M 0 pNqq 0 XNY 0D 0 e0\8 0( H0 PNQ, 0 PN Q0 DNE00 PN0Q 0 \N ] 0 DNET0@ N0 ] 0\04N0 0X8N04N 0hqhN04N 04 N Q 0 @NA 0 @NA 0 TNU 0 HNI 0 LNM 08 N U 0 HN0I0T N u(0\ N } 0` N 0 \N ] 0H 4N* NT NNA0 NV NN? NX NN? NZ N\ N N^ N` N Nb 4 Nd * Nf Nh Nj 1 Nl Nn Np NN Nr N Nt N Nv Nx N Nz N N| N N~ N N NN N N N N N N N NN N N N N N N N N N N N NN N N N NN N NN N NNN N N NN
p N N N N NT
y
0 lNqm 0 Nq NJ NL Tz
;<0M-,0Q 5+; ;T
8
; <N0= ; 4N;5 ;< 0 =$ ; ; 0 ; ; N N N N N NNO N NG N N N NIH N N
1
N NT1
| ; LNM8 ; TNU@ ; PN N N N
N0 NT
}Z< \N N Tv $ oL0L/ 46 ( 씣o X씣 4 씣 8 씣 7 8 #T$ oL0N }, oX4 8 N E N T T T
p NT
q4$ @Np
q TN U
q DN E
qL(NN h
q @ A,
q < =0
q HN N4 N
] N6 N8 N: N<4 N> N N@ N NB N T
p N p N q N q NT
N ) " \ " ! t@ i ! j
! ! ' ' }l'):
k$
#-4z l :
'33/nn|mo ~3\}z $ &q ȁ z%
$%N!!!!!"
""""" ! ! ! "# #
#'$
"#m#m#o#}$;$E$;$<$?$A$F$F$K%K%L%O%Q%T%W%[%z&%zm
$$
_go_.o 0 0 0 644 945509 `
go object freebsd amd64 go1.17.6 X:
build id "0cJ01ROgy-BU6pTFjQGJ/IwEVjKtGOZstHQdlD8A9"
!
go117ldzm T | | [ 6 \0 3_ 3_ r O N W | a (d m bufiobytesencodingfmtioreflectstrconvstringserrorssyncunicodeunicode/utf8encoding/xml.Marshaltype.*bytes.Buffertype.bytes.Buffertype.bufio.Writerruntime.gcWriteBarrierCXgo.itab.*bytes.Buffer,io.Writertype.encoding/xml.Encoderruntime.gcWriteBarrierencoding/xml.(*Encoder).Encoderuntime.panicSliceBgclocals·54d4a4d5c70e0fcce5df7f949b11bc4cgclocals·a763de393ed8163b574d49257368207aencoding/xml.Marshal.arginfo1gofile..$GOROOT/src/encoding/xml/marshal.gogofile..$GOROOT/src/bufio/bufio.gogofile..$GOROOT/src/bytes/buffer.goencoding/xml.NewEncoderbufio.NewWriterbufio.NewWriterSizebytes.(*Buffer).Bytestype.*bufio.Writertype.[]uint8go.info.interface {}go.info.[]uint8go.info.errorgo.info.*bytes.Buffergo.info.*bufio.Writergo.info.encoding/xml.NewEncoder$abstractgo.info.bufio.NewWriter$abstractgo.info.bufio.NewWriterSize$abstractgo.info.bytes.(*Buffer).Bytes$abstractencoding/xml.MarshalIndentruntime.gcWriteBarrierDXgclocals·90b6c4caddb85c8e4e9d0455d0fcc5dfencoding/xml.MarshalIndent.arginfo1encoding/xml.(*Encoder).Indentgo.info.stringgo.info.*encoding/xml.Encodergo.info.encoding/xml.(*Encoder).Indent$abstractgo.itab.*bufio.Writer,io.Writergclocals·ac25fd02b55a71fa32f691fc8a685923gclocals·1dc253a70a02e34230da2789b87b3619encoding/xml.NewEncoder.arginfo1type.*encoding/xml.Encodergclocals·eb531acb5904ccae6b8487875667de48gclocals·69c1753bd5f81501d95132d08af04464encoding/xml.(*Encoder).Indent.arginfo1reflect.dummyencoding/xml.(*printer).marshalValuebufio.(*Writer).Flushgclocals·2d436521505a0428fce806909067d587gclocals·d8b28f51bb91e05d264803f0f600a200encoding/xml.(*Encoder).Encode.stkobjencoding/xml.(*Encoder).Encode.arginfo1gofile..$GOROOT/src/reflect/value.gogofile..$GOROOT/src/reflect/type.goreflect.ValueOfreflect.escapesreflect.unpackEfacereflect.(*rtype).Kindreflect.ifaceIndirgo.info.reflect.ValueOf$abstractgo.info.reflect.escapes$abstractgo.info.reflect.unpackEface$abstractgo.info.reflect.(*rtype).Kind$abstractgo.info.reflect.ifaceIndir$abstractencoding/xml.(*Encoder).EncodeElementgclocals·4554cd87a6f5ed5f023507c1e092c4e1encoding/xml.(*Encoder).EncodeElement.stkobjencoding/xml.(*Encoder).EncodeElement.arginfo1go.info.encoding/xml.StartElementencoding/xml.(*Encoder).EncodeTokentype.*encoding/xml.printertype.encoding/xml.Commentencoding/xml.endCommentbytes.Indexgo.string."xml: EncodeToken of Comment containing --> marker"fmt.Errorfgo.string."<!--"bufio.(*Writer).WriteStringbufio.(*Writer).Writego.string."-->"type.encoding/xml.Directiveencoding/xml.isValidDirectivego.string."<!"go.string.">"go.string."xml: EncodeToken of Directive containing wrong < or > markers"type.encoding/xml.ProcInstgo.string."xml: EncodeToken of ProcInst xml target only valid for xml declaration, first token encoded"encoding/xml.isNameStringencoding/xml.endProcInstgo.string."<?"bufio.(*Writer).WriteBytego.string."?>"go.string."xml: EncodeToken of ProcInst containing ?> marker"go.string."xml: EncodeToken of ProcInst with invalid Target"type.encoding/xml.EndElementencoding/xml.(*printer).writeEndtype.encoding/xml.CharDatago.itab.*encoding/xml.printer,io.Writerencoding/xml.escapeTexttype.encoding/xml.StartElementencoding/xml.(*printer).writeStartgo.string."xml: EncodeToken of invalid token type"gclocals·d89d870e12fae21d2684d97f742a242fgclocals·f95ef38c37536014f8f7343bbb525ba8encoding/xml.(*Encoder).EncodeToken.stkobjencoding/xml.(*Encoder).EncodeToken.arginfo1gofile..$GOROOT/src/bytes/bytes.gobytes.Containsencoding/xml.(*printer).cachedWriteErrorbufio.(*Writer).Bufferedtype.intgo.info.encoding/xml.Tokengo.info.encoding/xml.CharDatago.info.encoding/xml.Commentgo.info.encoding/xml.ProcInstgo.info.encoding/xml.Directivego.info.bytes.Contains$abstractgo.info.encoding/xml.(*printer).cachedWriteError$abstractgo.info.bufio.(*Writer).Buffered$abstractencoding/xml.begCommentruntime.panicSliceAcapgclocals·1a65e721a2ccc325b382662e7ffee780encoding/xml.isValidDirective.arginfo1bytes.Equalgo.info.boolgo.info.intgo.info.uint8go.info.bytes.Equal$abstractencoding/xml.(*Encoder).Flushgclocals·e6397a44f8e1b6e77d0f200b4fba5269encoding/xml.(*Encoder).Flush.arginfo1encoding/xml.(*printer).createAttrPrefixtype.map[string]stringgo.string."http://www.w3.org/XML/1998/namespace"go.string."/"strings.TrimRightstrings.LastIndexencoding/xml.isNamego.string.":"strings.Indexgo.string."_"go.string."xml"strings.EqualFoldgo.string."xmlns:"go.string."=\""go.string."\" "strconv.FormatIntgclocals·52624aab0fe579598eccfe30d57e1a78gclocals·20d62d187f4813a4cc38e68c7dd9516bencoding/xml.(*printer).createAttrPrefix.arginfo1gofile..$GOROOT/src/encoding/xml/xml.gogofile..$GOROOT/src/strings/strings.gogofile..$GOROOT/src/strconv/itoa.gostrings.Containsencoding/xml.EscapeTextstrconv.Itoatype.[32]uint8go.info.*encoding/xml.printergo.info.strings.Contains$abstractgo.info.encoding/xml.EscapeText$abstractgo.info.strconv.Itoa$abstractencoding/xml.(*printer).deleteAttrPrefixgclocals·5e326a2f5498e528ce8fbe7bd86e7d21gclocals·663f8c6bfa83aa777198789ce63d9ab4encoding/xml.(*printer).deleteAttrPrefix.arginfo1go.info.encoding/xml.(*printer).deleteAttrPrefix$abstractencoding/xml.(*printer).markPrefixencoding/xml.(*printer).markPrefix.arginfo1go.info.encoding/xml.(*printer).markPrefix$abstractencoding/xml.(*printer).popPrefixgclocals·0e942f96b37a3a54dce69fe4b1f12e5agclocals·bfbff96882bb1901993edd815eef6181encoding/xml.(*printer).popPrefix.arginfo1go.info.encoding/xml.(*printer).popPrefix$abstracttype.*reflect.ValueErrortype.reflect.Typetype.*encoding/xml.UnsupportedTypeErrorgo.string."xml: EncodeElement of StartElement with missing name"encoding/xml.isEmptyValuereflect.Value.Elemreflect.Value.Typeencoding/xml.marshalerTypereflect.Value.Addrencoding/xml.textMarshalerTypereflect.Value.Lenencoding/xml.getTypeInfoencoding/xml.(*fieldInfo).valuereflect.valueInterfacetype.encoding/xml.Nametype.encoding/xml.Attrtype.encoding/xml.UnsupportedTypeErrorgo.itab.*encoding/xml.UnsupportedTypeError,errortype.encoding.TextMarshalerencoding/xml.defaultStartencoding/xml.(*printer).marshalTextInterfacetype.encoding/xml.Marshalerencoding/xml.(*printer).marshalInterfaceencoding/xml.(*printer).marshalAttrencoding/xml.(*printer).marshalStructencoding/xml.(*printer).marshalSimpleencoding/xml.(*printer).EscapeStringruntime.panicIndexreflect.Value.Indextype.reflect.ValueErrorgo.string."reflect.Value.CanInterface"go.string."reflect.Value.IsNil"gclocals·2c3a7c29bf83c2b098f9abce94875935gclocals·32fa0f19f23a0b1867e947bd7d1e4bc8encoding/xml.(*printer).marshalValue.stkobjencoding/xml.(*printer).marshalValue.arginfo1reflect.Value.IsValidreflect.Value.Kindreflect.flag.kindreflect.Value.IsNilreflect.Value.CanInterfacereflect.Value.CanAddrreflect.Value.Interfacetype.*encoding/xml.Attrtype.*reflect.rtypego.info.reflect.Valuego.info.*encoding/xml.fieldInfogo.info.*encoding/xml.StartElementgo.info.*encoding/xml.typeInfogo.info.reflect.Typego.info.encoding/xml.Namego.info.reflect.Value.IsValid$abstractgo.info.reflect.Value.Kind$abstractgo.info.reflect.flag.kind$abstractgo.info.reflect.Value.IsNil$abstractgo.info.reflect.Value.CanInterface$abstractgo.info.reflect.Value.CanAddr$abstractgo.info.reflect.Value.Interface$abstracttype.encoding/xml.MarshalerAttrencoding/xml.marshalerAttrTypeencoding/xml.attrTypetype.interface {}gclocals·c39c9eb5cd2adf46a48f0053d87b1cd0gclocals·6bdaad78f376ad36397e0814cd269967encoding/xml.(*printer).marshalAttr.arginfo1type.reflect.flaggo.info.encoding/xml.Attrgclocals·fc3cefaec4e9bc759ca6a60f519fefedgclocals·ff4d33dffebfa31e865bfb913a69ae0eencoding/xml.defaultStart.arginfo1encoding/xml.receiverTypego.string."xml: %s.MarshalXML wrote invalid XML: <%s> not closed"gclocals·4a64b9724baeaf627947f3f61be31907gclocals·03c74d1438984e48234ded92b346bb22encoding/xml.(*printer).marshalInterface.stkobjencoding/xml.(*printer).marshalInterface.arginfo1type.[2]interface {}go.info.encoding/xml.Marshalergclocals·f39d08f7ca8f4040868f3da9914224eegclocals·7d2d5fca80364273fb07d5820a76fef4encoding/xml.(*printer).marshalTextInterface.stkobjencoding/xml.(*printer).marshalTextInterface.arginfo1go.info.encoding.TextMarshalerruntime.gcWriteBarrierSIencoding/xml.(*printer).writeIndentgo.string." xmlns=\""go.string."xml: start tag with no name"gclocals·ed81ee488d434964f7a11f70c8cad102gclocals·3f9a4e01e3d9f1da72aabde064e559eaencoding/xml.(*printer).writeStart.arginfo1go.string."xml: end tag </%s> does not match start tag <%s>"go.string."xml: end tag </%s> in namespace %s does not match start tag <%s> in namespace %s"go.string."xml: end tag </%s> without start tag"go.string."xml: end tag with no name"gclocals·a4dee5583ba8ffa60c849d11b83f3a32gclocals·4c6ed6bba930c7133404d9c1198c43c6encoding/xml.(*printer).writeEnd.stkobjencoding/xml.(*printer).writeEnd.arginfo1type.[1]interface {}type.[4]interface {}strconv.FormatUintreflect.Value.Boolgo.string."true"go.string."false"strconv.FormatFloatreflect.Value.Slicereflect.Value.Bytesreflect.Copyreflect.Value.Stringgclocals·1f39777ad3309676270988154e2e5f66gclocals·f6910b644b40b9da6303b080ece66a48encoding/xml.(*printer).marshalSimple.stkobjencoding/xml.(*printer).marshalSimple.arginfo1gofile..$GOROOT/src/strconv/atob.goreflect.Value.Intreflect.Value.Uintstrconv.FormatBoolreflect.Value.Floattype.reflect.Valuego.info.float64go.info.reflect.Value.Int$abstractgo.info.reflect.Value.Uint$abstractgo.info.strconv.FormatBool$abstractgo.info.reflect.Value.Float$abstractencoding/xml.indirectgclocals·a4a41b2ed11601860bcf8189b861a615encoding/xml.indirect.arginfo1encoding/xml.(*parentStack).trimgo.string."--"encoding/xml.ddBytesencoding/xml.(*parentStack).pushencoding/xml.emitCDATA·fencoding/xml.EscapeText·ftype.[64]uint8strconv.AppendUintstrconv.AppendIntstrconv.genericFtoago.string."xml: comments must not contain \"--\""go.string."xml: bad type for comment field of %s"encoding/xml..stmp_5gclocals·76d73be88c9a04b4924c504f61c1b4abgclocals·d2185864bdb1c1c2ad0f2128c0e6f0baencoding/xml.(*printer).marshalStruct.stkobjencoding/xml.(*printer).marshalStruct.arginfo1gofile..$GOROOT/src/strconv/ftoa.gostrconv.AppendBoolstrconv.AppendFloatgo.info.encoding/xml.parentStackgo.info.func(io.Writer, []uint8) errorgo.info.*[64]uint8go.info.reflect.Kindgo.info.strconv.AppendBool$abstractgo.info.strconv.AppendFloat$abstractencoding/xml.(*printer).cachedWriteError.arginfo1encoding/xml.(*printer).writeIndent.arginfo1gclocals·d8a6a1c32b1a341856445d5bba1779d3encoding/xml.(*parentStack).trim.arginfo1go.info.*encoding/xml.parentStackgo.info.[]stringgclocals·88b8ef1061af7b265667a658f5674487encoding/xml.(*parentStack).push.stkobjencoding/xml.(*parentStack).push.arginfo1encoding/xml.(*UnsupportedTypeError).Errorgo.string."xml: unsupported type: "gclocals·524d71b8d4b4126db12e7a6de3370d94encoding/xml.(*UnsupportedTypeError).Error.arginfo1go.info.*encoding/xml.UnsupportedTypeErrorgclocals·dc9b0298814590ca3ffc3a889546fc8bencoding/xml.isEmptyValue.arginfo1encoding/xml.Unmarshaltype.*bytes.Readertype.bytes.Readergo.itab.*bytes.Reader,io.Readerencoding/xml.NewDecoderencoding/xml.(*Decoder).DecodeElementgclocals·4ddf5df23561bb4290a54369f3effce5encoding/xml.Unmarshal.arginfo1gofile..$GOROOT/src/encoding/xml/read.gogofile..$GOROOT/src/bytes/reader.gobytes.NewReaderencoding/xml.(*Decoder).Decodego.info.bytes.NewReader$abstractgo.info.encoding/xml.(*Decoder).Decode$abstractgclocals·5207c493e17be99b5ba2331b72d2d660encoding/xml.(*Decoder).Decode.arginfo1type.*errors.errorStringtype.errors.errorStringgo.string."non-pointer passed to Unmarshal"go.itab.*errors.errorString,errorencoding/xml.(*Decoder).unmarshalgclocals·3cabec13d3c9833948fdd8997bac56e7encoding/xml.(*Decoder).DecodeElement.stkobjencoding/xml.(*Decoder).DecodeElement.arginfo1gofile..$GOROOT/src/errors/errors.goerrors.Newgo.info.*encoding/xml.Decodergo.info.errors.New$abstractencoding/xml.UnmarshalError.Errorencoding/xml.UnmarshalError.Error.arginfo1go.info.encoding/xml.UnmarshalErrorgo.itab.*reflect.rtype,reflect.Typego.string."("go.string.")"gclocals·5fa9533817f156deeae5f59bc231a09cgclocals·47a67f4fb109a79e4380e4f8459439e0encoding/xml.receiverType.stkobjencoding/xml.receiverType.arginfo1reflect.TypeOfreflect.toTypego.info.*uint8go.info.uintptrgo.info.reflect.TypeOf$abstractgo.info.reflect.toType$abstractencoding/xml.(*Decoder).unmarshalInterfacetype.encoding/xml.Unmarshalerruntime.gcWriteBarrierBXtype.encoding/xml.stackgo.string."xml: %s.UnmarshalXML did not consume entire <%s> element"gclocals·8785a91577abc2afa72ed4a84d977872gclocals·e8526a07f23c14a47dc0e578525b1facencoding/xml.(*Decoder).unmarshalInterface.stkobjencoding/xml.(*Decoder).unmarshalInterface.arginfo1encoding/xml.(*Decoder).pushEOFencoding/xml.(*Decoder).popEOFencoding/xml.(*Decoder).poptype.**encoding/xml.stackgo.info.encoding/xml.Unmarshalergo.info.encoding/xml.(*Decoder).pushEOF$abstractgo.info.encoding/xml.(*Decoder).popEOF$abstractgo.info.encoding/xml.(*Decoder).pop$abstractencoding/xml.(*Decoder).unmarshalTextInterfacetype.encoding.TextUnmarshalerencoding/xml.(*Decoder).Tokengclocals·2fd6ec2c48657f74d90f63617128c874encoding/xml.(*Decoder).unmarshalTextInterface.arginfo1go.info.encoding.TextUnmarshalerencoding/xml.(*Decoder).unmarshalAttrtype.encoding/xml.UnmarshalerAttrreflect.Newreflect.Value.Setencoding/xml.unmarshalerAttrTypeencoding/xml.textUnmarshalerTypereflect.Zeroreflect.Appendreflect.Value.SetLenencoding/xml.copyValuegclocals·47d0e70cbfc5a30a8525e4395b5cd61agclocals·9a5a27a553bf4c2977694565997e8f8cencoding/xml.(*Decoder).unmarshalAttr.stkobjencoding/xml.(*Decoder).unmarshalAttr.arginfo1type.[1]reflect.Valuetype.encoding/xml.UnmarshalErrorencoding/xml.unmarshalerTypeencoding/xml.(*Decoder).Skipgo.string."unknown type "encoding/xml.nameTypego.string."expected element type <"go.string."> but have <"go.itab.encoding/xml.UnmarshalError,errorgo.string."expected element <"go.string."> in name space "go.string." but have "go.string."no name space"encoding/xml.(*Decoder).unmarshalPathreflect.Value.SetStringgclocals·d561b75b826c941cbdc243f82ca74865gclocals·54523b97d1fc7c79ed1c13bf3dbe8a30encoding/xml.(*Decoder).unmarshal.stkobjencoding/xml.(*Decoder).unmarshal.arginfo1encoding/xml.(*Decoder).savedOffsetbytes.(*Buffer).Lengo.info.encoding/xml.(*Decoder).savedOffset$abstractgo.info.bytes.(*Buffer).Len$abstracttype.*strconv.NumErrorstrings.TrimSpacego.string."F"type.strconv.NumErrorgo.string."ParseBool"strconv.ErrSyntaxgo.itab.*strconv.NumError,errorreflect.Value.SetBoolstrconv.ParseIntreflect.Value.SetIntstrconv.ParseUintreflect.Value.SetUintstrconv.ParseFloatreflect.Value.SetFloatruntime.zerobasereflect.Value.SetBytesgo.string."cannot unmarshal into "gclocals·37a37d8c509ad2fbf63a427522d50b52gclocals·f439041fd4249fbbf74f02d92aa1a020encoding/xml.copyValue.arginfo1gofile..$GOROOT/src/strconv/atoi.gostrconv.ParseBoolstrconv.syntaxErrorgo.info.int64go.info.uint64go.info.strconv.ParseBool$abstractgo.info.strconv.syntaxError$abstractgclocals·790470ceaf5c7c827b1da8ea544263fdgclocals·a47af644c747f7ede1c5fe37d263b72fencoding/xml.(*Decoder).unmarshalPath.arginfo1encoding/xml.(*Decoder).Skip.arginfo1type.*encoding/xml.typeInfoencoding/xml.tinfoMapsync.(*Map).Loadtype.encoding/xml.typeInfosync.(*Map).LoadOrStoreruntime.duffcopyreflect.StructTag.Lookupencoding/xml.structFieldInfoencoding/xml.addFieldInfotype.[1]intgclocals·2e35813173a14014ceafa01221e78681gclocals·bee325cdf285138c2da4a40ce77b011dencoding/xml.getTypeInfo.stkobjencoding/xml.getTypeInfo.arginfo1gofile..$GOROOT/src/encoding/xml/typeinfo.goreflect.StructField.IsExportedreflect.StructTag.Gettype.*intgo.info.reflect.StructFieldgo.info.encoding/xml.fieldInfogo.info.reflect.StructField.IsExported$abstractgo.info.reflect.StructTag.Get$abstracttype.encoding/xml.fieldInfogo.string." "go.string.","strings.genSplitgo.string."xml: namespace without name in field %s of type %s: %q"encoding/xml.lookupXMLNamestrings.Joingo.string."xml: %s chain not valid with %s flag"runtime.duffzerogo.string."xml: name %q in tag of %s.%s conflicts with name %q in %s.XMLName"go.string."xml: trailing '>' in field %s of type %s"go.string."xml: invalid tag in field %s of type %s: %q"runtime.panicSliceAlengclocals·77494afb73d9cdfae7ae3caa55ed02e3gclocals·55530dab3461c11a550fa49e44e29240encoding/xml.structFieldInfo.stkobjencoding/xml.structFieldInfo.arginfo1strings.Splittype.*encoding/xml.fieldInfotype.[3]interface {}type.[5]interface {}go.info.*reflect.StructFieldgo.info.*stringgo.info.encoding/xml.fieldFlagsgo.info.strings.Split$abstractgclocals·2a1cd1a9006057b5c601b15dd5de8b98encoding/xml.lookupXMLName.stkobjencoding/xml.lookupXMLName.arginfo1encoding/xml.mingclocals·33cdeccccebe80329f1fdbee7f5874cbencoding/xml.min.arginfo1go.info.encoding/xml.min$abstracttype.*encoding/xml.TagPathErrortype.encoding/xml.TagPathErrorgo.itab.*encoding/xml.TagPathError,errorgclocals·a5cea158ac8001f4432994be883bb551gclocals·3551c9df9482938bf6fd846746fad64cencoding/xml.addFieldInfo.arginfo1type.*[]encoding/xml.fieldInfogo.info.[]intencoding/xml.(*TagPathError).Errorgo.string."%s field %q with tag %q conflicts with field %q with tag %q"fmt.Sprintfgclocals·38cd6c5dc113deaaac86733e20707ab7gclocals·cbe1b2792414e98868c07b50581fca51encoding/xml.(*TagPathError).Error.stkobjencoding/xml.(*TagPathError).Error.arginfo1go.info.*encoding/xml.TagPathErrorreflect.Value.Fieldgclocals·e87a65cefbf812f6fa0e345fab11173egclocals·b6cf5fd6ad97824398e89bc66dcc7835encoding/xml.(*fieldInfo).value.arginfo1encoding/xml.(*SyntaxError).Errorgo.string."XML syntax error on line "go.string.": "encoding/xml.(*SyntaxError).Error.arginfo1go.info.*encoding/xml.SyntaxErrorencoding/xml.StartElement.Copygclocals·fd5b0b1108b248c116d45ef128243859encoding/xml.StartElement.Copy.arginfo1go.info.encoding/xml.StartElement.Copy$abstractencoding/xml.StartElement.Endgclocals·b1aadbb56f2c1c6a5f4a64e57bbe91d2encoding/xml.StartElement.End.arginfo1go.info.encoding/xml.EndElementencoding/xml.makeCopygclocals·524fb25e39be6eaca45ee9a852c9bf62encoding/xml.makeCopy.arginfo1go.info.encoding/xml.makeCopy$abstractencoding/xml.CharData.Copyencoding/xml.CharData.Copy.arginfo1go.info.encoding/xml.CharData.Copy$abstractencoding/xml.Comment.Copyencoding/xml.Comment.Copy.arginfo1go.info.encoding/xml.Comment.Copy$abstractencoding/xml.ProcInst.Copygclocals·cd5c0fde60dbd808b1c99f8b1514b4eegclocals·768e8acda8fdd1ceedd6f115da21537dencoding/xml.ProcInst.Copy.arginfo1go.info.encoding/xml.ProcInst.Copy$abstractencoding/xml.Directive.Copyencoding/xml.Directive.Copy.arginfo1go.info.encoding/xml.Directive.Copy$abstractencoding/xml.CopyTokengclocals·704fed5101a93d7e232f28723a01d958gclocals·4d2462004d7a9b4a5527cc5c69aad4d5encoding/xml.CopyToken.stkobjencoding/xml.CopyToken.arginfo1type.encoding/xml.Tokentype.*bufio.Readertype.encoding/xml.Decodertype.io.ByteReadergo.itab.*bufio.Reader,io.Readertype.bufio.Readergo.itab.*bufio.Reader,io.ByteReadergclocals·dfbe7af6a7cbf27c78233021a45dc11egclocals·cb74d0a4ec93b0dfd886351096c67a3dencoding/xml.NewDecoder.arginfo1encoding/xml.(*Decoder).switchToReaderbufio.NewReaderbufio.NewReaderSizebufio.(*Reader).resettype.*encoding/xml.Decodergo.info.io.Readergo.info.*bufio.Readergo.info.encoding/xml.(*Decoder).switchToReader$abstractgo.info.bufio.NewReader$abstractgo.info.bufio.NewReaderSize$abstractgo.info.bufio.(*Reader).reset$abstractencoding/xml.NewTokenDecodergo.itab.*encoding/xml.Decoder,encoding/xml.TokenReadergclocals·5ab01d50500dae8aabc1119d8e7710caencoding/xml.NewTokenDecoder.arginfo1go.info.encoding/xml.TokenReadertype.*encoding/xml.SyntaxErrorio.EOFruntime.gcWriteBarrierR8encoding/xml.(*Decoder).rawTokenencoding/xml.(*Decoder).autoCloseencoding/xml.(*Decoder).popElementtype.encoding/xml.SyntaxErrorgo.string."unexpected EOF"go.itab.*encoding/xml.SyntaxError,errorruntime.gcWriteBarrierR9gclocals·d3bf373345785fa8a334141401f2cb6bgclocals·a29f7b8b6d1843c58931679448bd7d11encoding/xml.(*Decoder).Token.stkobjencoding/xml.(*Decoder).Token.arginfo1encoding/xml.(*Decoder).translateencoding/xml.(*Decoder).syntaxErrorencoding/xml.(*Decoder).pushElementencoding/xml.(*Decoder).pushencoding/xml.(*Decoder).pushNsgo.info.encoding/xml.(*Decoder).translate$abstractgo.info.encoding/xml.(*Decoder).syntaxError$abstractgo.info.encoding/xml.(*Decoder).pushElement$abstractgo.info.encoding/xml.(*Decoder).push$abstractgo.info.encoding/xml.(*Decoder).pushNs$abstractencoding/xml.(*Decoder).translate.arginfo1gclocals·09f4c2196049581da7c5c892d5ec195bgclocals·f4bafc7cb43cd73d238abf5acd894605encoding/xml.(*Decoder).switchToReader.arginfo1encoding/xml.(*Decoder).push.arginfo1type.*encoding/xml.stackgo.info.*encoding/xml.stackencoding/xml.(*Decoder).pop.arginfo1gclocals·2d7c1615616d4cf40d01b3385155ed6eencoding/xml.(*Decoder).pushEOF.arginfo1encoding/xml.(*Decoder).popEOF.arginfo1encoding/xml.(*Decoder).pushElement.arginfo1encoding/xml.(*Decoder).pushNs.arginfo1encoding/xml.(*Decoder).syntaxError.arginfo1go.string."element <"go.string."> in space "go.string."closed by </"go.string."> closed by </"go.string."unexpected end element </"gclocals·cf2aaccd7239dbf301982ee53700714bgclocals·6dfe9a2d370450cec3f6bd0c8ea2d8c0encoding/xml.(*Decoder).popElement.stkobjencoding/xml.(*Decoder).popElement.arginfo1type.[8]stringgo.info.*encoding/xml.EndElementstrings.ToLowergclocals·9ef705216e90d6d7a81bb7a112f2160cgclocals·4cc41214fbe2db1b686e430dc57cf720encoding/xml.(*Decoder).autoClose.stkobjencoding/xml.(*Decoder).autoClose.arginfo1encoding/xml.(*Decoder).RawTokenencoding/xml.errRawTokengclocals·6b4b7e46e7c3e785dae149c064ae0142encoding/xml.(*Decoder).RawToken.arginfo1type.encoding/xml.TokenReaderencoding/xml.(*Decoder).getcencoding/xml.(*Decoder).mustgetcencoding/xml.(*Decoder).nsnamego.string."expected element name after <"encoding/xml.(*Decoder).nameencoding/xml.(*Decoder).spacego.string."expected target name after <?"go.string."expected element name after </"go.string."invalid characters between </"go.string." and >"bytes.(*Buffer).WriteBytego.string."invalid sequence <!- not part of <!--"encoding/xml.(*Decoder).textgo.string."invalid sequence \"--\" not allowed in comments"go.string."!--"encoding/xml..stmp_6go.string."CDATA["go.string."invalid <![ sequence"go.string."version"encoding/xml.procInstgo.string."xml: unsupported version %q; only version 1.0 is supported"go.string."encoding"go.string."utf-8"type.io.Readergo.string."xml: opening charset %q: %v"go.string."xml: encoding %q declared but Decoder.CharsetReader is nil"go.string."CharsetReader returned a nil Reader for charset "encoding/xml.(*Decoder).attrvalgo.string."attribute name without = in element"go.string."expected attribute name in element"go.string."expected /> in element"gclocals·c64e349a67ca6e837afea97502ff4f63gclocals·0617245c39c6d351dfc5d2fda71fcc9dencoding/xml.(*Decoder).rawToken.stkobjencoding/xml.(*Decoder).rawToken.arginfo1encoding/xml.(*Decoder).ungetcbytes.(*Buffer).Resetbytes.(*Buffer).Truncatego.info.[]encoding/xml.Attrgo.info.encoding/xml.(*Decoder).ungetc$abstractgo.info.bytes.(*Buffer).Reset$abstractgo.info.bytes.(*Buffer).Truncate$abstractgo.string."unquoted or missing attribute value in element"gclocals·0a2845762fc5dafeed515f8eba948078gclocals·9783710103695d7171ee820ce562d18dencoding/xml.(*Decoder).attrval.arginfo1encoding/xml.(*Decoder).space.arginfo1encoding/xml.(*Decoder).getc.arginfo1encoding/xml.(*Decoder).InputOffsetencoding/xml.(*Decoder).InputOffset.arginfo1encoding/xml.(*Decoder).savedOffset.arginfo1encoding/xml.(*Decoder).mustgetc.arginfo1encoding/xml.(*Decoder).ungetc.arginfo1encoding/xml.(*Decoder).readNameencoding/xml.entitytype.map[string]int32go.string."unescaped ]]> not in CDATA section"go.string."unescaped < inside quoted string"go.string."unexpected EOF in CDATA section"unicode/utf8.DecodeRunego.string."invalid UTF-8"go.string."illegal character code %U"go.string." (no semicolon)"go.string."invalid character entity "bytes.(*Buffer).Writeencoding/xml..stmp_7gclocals·ca987dafd0064ffd588a36717db71573gclocals·ca359685051ba4e56354604e3f332b38encoding/xml.(*Decoder).text.stkobjencoding/xml.(*Decoder).text.arginfo1encoding/xml.isInCharacterRangetype.[4]uint8go.info.int32go.info.encoding/xml.isInCharacterRange$abstractencoding/xml.isInCharacterRange.arginfo1strings.Countgclocals·0bc550b6b95948f318d057651e9cddeaencoding/xml.(*Decoder).nsname.arginfo1go.string."invalid XML name: "gclocals·cbd2de324c457a734fe49f4b438f8013encoding/xml.(*Decoder).name.arginfo1gclocals·c7c4fc7b12f6707ea74acf7400192967encoding/xml.(*Decoder).readName.arginfo1encoding/xml.isNameBytego.info.encoding/xml.isNameByte$abstractencoding/xml.isNameByte.arginfo1encoding/xml.firstunicode.Isencoding/xml.secondencoding/xml.isName.arginfo1unicode/utf8.DecodeRuneInStringencoding/xml.isNameString.arginfo1gclocals·2c1baa9945a61fd8172c3a07f281832aencoding/xml.EscapeText.arginfo1type.io.Writerencoding/xml.escNLencoding/xml.escTabencoding/xml.escQuotencoding/xml.escCRencoding/xml.escAposencoding/xml.escAmpencoding/xml.escFFFDencoding/xml.escGTencoding/xml.escLTgclocals·7f7900e38a5fcd5832ee15fdac79db2bencoding/xml.escapeText.arginfo1go.info.io.Writerencoding/xml.(*printer).EscapeString.arginfo1encoding/xml.Escapegclocals·d3936e1b3d07fdfa679fc414be0d6ac6encoding/xml.Escape.arginfo1encoding/xml.emitCDATAencoding/xml.cdataStartencoding/xml.cdataEndencoding/xml.cdataEscapegclocals·00c2ba78c8ed7d3854e801b41cd70ad6gclocals·47503189490edb7552d51eabf5d0e487encoding/xml.emitCDATA.arginfo1go.string."="strings.IndexRunegclocals·8e6444693d825c8b7fadcb81d07d5bb6gclocals·a5055cd68876ca89b660e46f7e21fd17encoding/xml.procInst.arginfo1encoding/xml.inittype.*encoding/xml.Marshalertype.*encoding/xml.MarshalerAttrtype.*encoding.TextMarshalertype.*encoding/xml.Unmarshalertype.*encoding/xml.UnmarshalerAttrtype.*encoding.TextUnmarshalergo.string."xml: cannot use RawToken from UnmarshalXML method"go.string."lt"go.string."gt"go.string."amp"go.string."apos"go.string."quot"encoding/xml..stmp_9encoding/xml..stmp_8encoding/xml.htmlEntityencoding/xml.HTMLEntitygclocals·f86c5b7d716428d81fa8b127db0ab56dencoding/xml.init.stkobjencoding/xml.(*printer).Availablebufio.(*Writer).Availableencoding/xml.(*printer).Available.arginfo1gofile..<autogenerated>encoding/xml.(*printer).Bufferedencoding/xml.(*printer).Buffered.arginfo1encoding/xml.(*printer).Flushencoding/xml.(*printer).Flush.arginfo1encoding/xml.(*printer).ReadFrombufio.(*Writer).ReadFromgclocals·4a654ab1a384d3c3833c9a657d2f5589encoding/xml.(*printer).ReadFrom.arginfo1encoding/xml.(*printer).Resetbufio.(*Writer).Resetgclocals·267260df189670137001aef19b5fd4fcencoding/xml.(*printer).Reset.arginfo1encoding/xml.(*printer).Sizebufio.(*Writer).Sizeencoding/xml.(*printer).Size.arginfo1encoding/xml.(*printer).Writegclocals·21e863e2261befa92f8534560680bbb6encoding/xml.(*printer).Write.arginfo1encoding/xml.(*printer).WriteBytegclocals·4032f753396f2012ad1784f398b170f4encoding/xml.(*printer).WriteByte.arginfo1encoding/xml.(*printer).WriteRunebufio.(*Writer).WriteRuneencoding/xml.(*printer).WriteRune.arginfo1encoding/xml.(*printer).WriteStringgclocals·8999307b7be34fc1fb41dca3d5345ce3encoding/xml.(*printer).WriteString.arginfo1go.builtin.error.Errorgclocals·abb2c5050fe821353449583ee1559325go.builtin.error.Error.arginfo1type..eq.encoding/xml.Nametype..eq.encoding/xml.Name.arginfo1go.info.*encoding/xml.Nametype..eq.encoding/xml.Attrtype..eq.encoding/xml.Attr.arginfo1go.info.*encoding/xml.Attrencoding/xml.(*CharData).Copygclocals·20d03ed1e78a744e298f739bbde3ad6fencoding/xml.(*CharData).Copy.arginfo1type.*encoding/xml.CharDataencoding/xml.(*Comment).Copyencoding/xml.(*Comment).Copy.arginfo1type.*encoding/xml.Commentencoding/xml.TokenReader.Tokengclocals·52e1e78c9dd0776ddbac279da079cbc0encoding/xml.TokenReader.Token.arginfo1type..eq.encoding/xml.stacktype..eq.encoding/xml.stack.arginfo1encoding/xml.(*StartElement).Copygclocals·c0f27f20e5860e6dff8f813b1fa10930gclocals·333844bb1593c4995d54986a4c6a0ceeencoding/xml.(*StartElement).Copy.arginfo1type.*encoding/xml.StartElementencoding/xml.(*StartElement).Endgclocals·b54c265fcfcc2aae36a147f86c7f459fencoding/xml.(*StartElement).End.arginfo1type..eq.encoding/xml.EndElementtype..eq.encoding/xml.EndElement.arginfo1encoding/xml.Unmarshaler.UnmarshalXMLgclocals·ede359bde83de2cc27cd6080027dfd4eencoding/xml.Unmarshaler.UnmarshalXML.arginfo1encoding/xml.(*Directive).Copyencoding/xml.(*Directive).Copy.arginfo1type.*encoding/xml.Directiveencoding/xml.Marshaler.MarshalXMLencoding/xml.Marshaler.MarshalXML.arginfo1encoding/xml.printer.Availablegclocals·620ec3e34337c350883e5e1ba1345693encoding/xml.printer.Available.arginfo1type.encoding/xml.printerencoding/xml.printer.Bufferedencoding/xml.printer.Buffered.arginfo1encoding/xml.printer.Flushgclocals·d6370867f748bb56ce7f82bfe6c5785eencoding/xml.printer.Flush.arginfo1encoding/xml.printer.ReadFromgclocals·7d6beaf971e42403aa9c2f4a0a2aa2c3encoding/xml.printer.ReadFrom.arginfo1encoding/xml.printer.Resetgclocals·7f9af5a34839b17df31485adc56649a2encoding/xml.printer.Reset.arginfo1encoding/xml.printer.Sizeencoding/xml.printer.Size.arginfo1encoding/xml.printer.Writegclocals·e12b012cf94ceaf2519fcc92c456513aencoding/xml.printer.Write.arginfo1encoding/xml.printer.WriteBytegclocals·ed1f07464f67e0d021ebffcb1d9f43eaencoding/xml.printer.WriteByte.arginfo1encoding/xml.printer.WriteRunegclocals·35ca7a1d14a234ec3a0408af16100033encoding/xml.printer.WriteRune.arginfo1encoding/xml.printer.WriteStringgclocals·58a84f9e20f9e3b9b25378502d5532e4encoding/xml.printer.WriteString.arginfo1encoding/xml.MarshalerAttr.MarshalXMLAttrgclocals·eb65c8b7b17f5ddb04db64405de908f5gclocals·2ccc456f25ac0bd2c96e30a4513f7779encoding/xml.MarshalerAttr.MarshalXMLAttr.arginfo1encoding/xml.(*ProcInst).Copygclocals·849e1e7d303439830e99fbf795ae21b6gclocals·072551bc0c2c1daf0df00df938353d58encoding/xml.(*ProcInst).Copy.arginfo1type.*encoding/xml.ProcInsttype..eq.encoding/xml.SyntaxErrortype..eq.encoding/xml.SyntaxError.arginfo1type..eq.encoding/xml.TagPathErrortype..eq.encoding/xml.TagPathError.arginfo1encoding/xml.(*UnmarshalError).Errorencoding/xml.(*UnmarshalError).Error.arginfo1type.*encoding/xml.UnmarshalErrorencoding/xml.UnmarshalerAttr.UnmarshalXMLAttrgclocals·4386a2ae34f169198eb4b7ab85ff348aencoding/xml.UnmarshalerAttr.UnmarshalXMLAttr.arginfo1type..eq.[2]interface {}type..eq.[2]interface {}.arginfo1go.info.*[2]interface {}type..eq.[3]interface {}type..eq.[3]interface {}.arginfo1go.info.*[3]interface {}type..eq.[4]interface {}type..eq.[4]interface {}.arginfo1go.info.*[4]interface {}type..eq.[5]interface {}type..eq.[5]interface {}.arginfo1go.info.*[5]interface {}type..eq.[8]stringtype..eq.[8]string.arginfo1go.info.*[8]stringgo.cuinfo.packagename.encoding/xmlencoding/xml..gobytes.1encoding/xml..gobytes.2encoding/xml..gobytes.3encoding/xml..gobytes.4go.string."basefont"go.string."br"go.string."area"go.string."link"go.string."img"go.string."param"go.string."hr"go.string."input"go.string."col"go.string."frame"go.string."isindex"go.string."base"go.string."meta"encoding/xml..gobytes.5encoding/xml..gobytes.6encoding/xml..gobytes.7encoding/xml..gobytes.8encoding/xml..gobytes.9encoding/xml..gobytes.10encoding/xml..gobytes.11encoding/xml..gobytes.12encoding/xml..gobytes.13encoding/xml..gobytes.14encoding/xml..gobytes.15encoding/xml..gobytes.16encoding/xml..inittaskbufio..inittaskbytes..inittaskfmt..inittaskio..inittaskreflect..inittaskstrconv..inittaskstrings..inittaskerrors..inittasksync..inittaskunicode..inittasktype.reflect.Kindgo.info.reflect.flaggo.info.unsafe.Pointertype.reflect.emptyInterfacego.info.reflect.emptyInterfacego.info.*reflect.rtypetype.reflect.StructTaggo.info.reflect.StructTagtype.[]stringtype.*reflect.emptyInterfacego.info.*reflect.emptyInterfacego.info.io.ByteReadergo.string.""go.string."reflect.Value.Int"go.string."reflect.Value.Uint"go.string."reflect.Value.Float"go.string."can't happen"go.string."bytes.Buffer: truncation out of range"go.string."nbsp"go.string."iexcl"go.string."cent"go.string."pound"go.string."curren"go.string."yen"go.string."brvbar"go.string."sect"go.string."uml"go.string."copy"go.string."ordf"go.string."laquo"go.string."not"go.string."shy"go.string."reg"go.string."macr"go.string."deg"go.string."plusmn"go.string."sup2"go.string."sup3"go.string."acute"go.string."micro"go.string."para"go.string."middot"go.string."cedil"go.string."sup1"go.string."ordm"go.string."raquo"go.string."frac14"go.string."frac12"go.string."frac34"go.string."iquest"go.string."Agrave"go.string."Aacute"go.string."Acirc"go.string."Atilde"go.string."Auml"go.string."Aring"go.string."AElig"go.string."Ccedil"go.string."Egrave"go.string."Eacute"go.string."Ecirc"go.string."Euml"go.string."Igrave"go.string."Iacute"go.string."Icirc"go.string."Iuml"go.string."ETH"go.string."Ntilde"go.string."Ograve"go.string."Oacute"go.string."Ocirc"go.string."Otilde"go.string."Ouml"go.string."times"go.string."Oslash"go.string."Ugrave"go.string."Uacute"go.string."Ucirc"go.string."Uuml"go.string."Yacute"go.string."THORN"go.string."szlig"go.string."agrave"go.string."aacute"go.string."acirc"go.string."atilde"go.string."auml"go.string."aring"go.string."aelig"go.string."ccedil"go.string."egrave"go.string."eacute"go.string."ecirc"go.string."euml"go.string."igrave"go.string."iacute"go.string."icirc"go.string."iuml"go.string."eth"go.string."ntilde"go.string."ograve"go.string."oacute"go.string."ocirc"go.string."otilde"go.string."ouml"go.string."divide"go.string."oslash"go.string."ugrave"go.string."uacute"go.string."ucirc"go.string."uuml"go.string."yacute"go.string."thorn"go.string."yuml"go.string."fnof"go.string."Alpha"go.string."Beta"go.string."Gamma"go.string."Delta"go.string."Epsilon"go.string."Zeta"go.string."Eta"go.string."Theta"go.string."Iota"go.string."Kappa"go.string."Lambda"go.string."Mu"go.string."Nu"go.string."Xi"go.string."Omicron"go.string."Pi"go.string."Rho"go.string."Sigma"go.string."Tau"go.string."Upsilon"go.string."Phi"go.string."Chi"go.string."Psi"go.string."Omega"go.string."alpha"go.string."beta"go.string."gamma"go.string."delta"go.string."epsilon"go.string."zeta"go.string."eta"go.string."theta"go.string."iota"go.string."kappa"go.string."lambda"go.string."mu"go.string."nu"go.string."xi"go.string."omicron"go.string."pi"go.string."rho"go.string."sigmaf"go.string."sigma"go.string."tau"go.string."upsilon"go.string."phi"go.string."chi"go.string."psi"go.string."omega"go.string."thetasym"go.string."upsih"go.string."piv"go.string."bull"go.string."hellip"go.string."prime"go.string."Prime"go.string."oline"go.string."frasl"go.string."weierp"go.string."image"go.string."real"go.string."trade"go.string."alefsym"go.string."larr"go.string."uarr"go.string."rarr"go.string."darr"go.string."harr"go.string."crarr"go.string."lArr"go.string."uArr"go.string."rArr"go.string."dArr"go.string."hArr"go.string."forall"go.string."part"go.string."exist"go.string."empty"go.string."nabla"go.string."isin"go.string."notin"go.string."ni"go.string."prod"go.string."sum"go.string."minus"go.string."lowast"go.string."radic"go.string."prop"go.string."infin"go.string."ang"go.string."and"go.string."or"go.string."cap"go.string."cup"go.string."int"go.string."there4"go.string."sim"go.string."cong"go.string."asymp"go.string."ne"go.string."equiv"go.string."le"go.string."ge"go.string."sub"go.string."sup"go.string."nsub"go.string."sube"go.string."supe"go.string."oplus"go.string."otimes"go.string."perp"go.string."sdot"go.string."lceil"go.string."rceil"go.string."lfloor"go.string."rfloor"go.string."lang"go.string."rang"go.string."loz"go.string."spades"go.string."clubs"go.string."hearts"go.string."diams"go.string."OElig"go.string."oelig"go.string."Scaron"go.string."scaron"go.string."Yuml"go.string."circ"go.string."tilde"go.string."ensp"go.string."emsp"go.string."thinsp"go.string."zwnj"go.string."zwj"go.string."lrm"go.string."rlm"go.string."ndash"go.string."mdash"go.string."lsquo"go.string."rsquo"go.string."sbquo"go.string."ldquo"go.string."rdquo"go.string."bdquo"go.string."dagger"go.string."Dagger"go.string."permil"go.string."lsaquo"go.string."rsaquo"go.string."euro"go.string."\u00a0"go.string."¡"go.string."¢"go.string."£"go.string."¤"go.string."¥"go.string."¦"go.string."§"go.string."¨"go.string."©"go.string."ª"go.string."«"go.string."¬"go.string."\u00ad"go.string."®"go.string."¯"go.string."°"go.string."±"go.string."²"go.string."³"go.string."´"go.string."µ"go.string."¶"go.string."·"go.string."¸"go.string."¹"go.string."º"go.string."»"go.string."¼"go.string."½"go.string."¾"go.string."¿"go.string."À"go.string."Á"go.string."Â"go.string."Ã"go.string."Ä"go.string."Å"go.string."Æ"go.string."Ç"go.string."È"go.string."É"go.string."Ê"go.string."Ë"go.string."Ì"go.string."Í"go.string."Î"go.string."Ï"go.string."Ð"go.string."Ñ"go.string."Ò"go.string."Ó"go.string."Ô"go.string."Õ"go.string."Ö"go.string."×"go.string."Ø"go.string."Ù"go.string."Ú"go.string."Û"go.string."Ü"go.string."Ý"go.string."Þ"go.string."ß"go.string."à"go.string."á"go.string."â"go.string."ã"go.string."ä"go.string."å"go.string."æ"go.string."ç"go.string."è"go.string."é"go.string."ê"go.string."ë"go.string."ì"go.string."í"go.string."î"go.string."ï"go.string."ð"go.string."ñ"go.string."ò"go.string."ó"go.string."ô"go.string."õ"go.string."ö"go.string."÷"go.string."ø"go.string."ù"go.string."ú"go.string."û"go.string."ü"go.string."ý"go.string."þ"go.string."ÿ"go.string."ƒ"go.string."Α"go.string."Β"go.string."Γ"go.string."Δ"go.string."Ε"go.string."Ζ"go.string."Η"go.string."Θ"go.string."Ι"go.string."Κ"go.string."Λ"go.string."Μ"go.string."Ν"go.string."Ξ"go.string."Ο"go.string."Π"go.string."Ρ"go.string."Σ"go.string."Τ"go.string."Υ"go.string."Φ"go.string."Χ"go.string."Ψ"go.string."Ω"go.string."α"go.string."β"go.string."γ"go.string."δ"go.string."ε"go.string."ζ"go.string."η"go.string."θ"go.string."ι"go.string."κ"go.string."λ"go.string."μ"go.string."ν"go.string."ξ"go.string."ο"go.string."π"go.string."ρ"go.string."ς"go.string."σ"go.string."τ"go.string."υ"go.string."φ"go.string."χ"go.string."ψ"go.string."ω"go.string."ϑ"go.string."ϒ"go.string."ϖ"go.string."•"go.string."…"go.string."′"go.string."″"go.string."‾"go.string."⁄"go.string."℘"go.string."ℑ"go.string."ℜ"go.string."™"go.string."ℵ"go.string."←"go.string."↑"go.string."→"go.string."↓"go.string."↔"go.string."↵"go.string."⇐"go.string."⇑"go.string."⇒"go.string."⇓"go.string."⇔"go.string."∀"go.string."∂"go.string."∃"go.string."∅"go.string."∇"go.string."∈"go.string."∉"go.string."∋"go.string."∏"go.string."∑"go.string."−"go.string."∗"go.string."√"go.string."∝"go.string."∞"go.string."∠"go.string."∧"go.string."∨"go.string."∩"go.string."∪"go.string."∫"go.string."∴"go.string."∼"go.string."≅"go.string."≈"go.string."≠"go.string."≡"go.string."≤"go.string."≥"go.string."⊂"go.string."⊃"go.string."⊄"go.string."⊆"go.string."⊇"go.string."⊕"go.string."⊗"go.string."⊥"go.string."⋅"go.string."⌈"go.string."⌉"go.string."⌊"go.string."⌋"go.string."〈"go.string."〉"go.string."◊"go.string."♠"go.string."♣"go.string."♥"go.string."♦"go.string."\""go.string."&"go.string."<"go.string."Œ"go.string."œ"go.string."Š"go.string."š"go.string."Ÿ"go.string."ˆ"go.string."˜"go.string."\u2002"go.string."\u2003"go.string."\u2009"go.string."\u200c"go.string."\u200d"go.string."\u200e"go.string."\u200f"go.string."–"go.string."—"go.string."‘"go.string."’"go.string."‚"go.string."“"go.string."”"go.string."„"go.string."†"go.string."‡"go.string."‰"go.string."‹"go.string."›"go.string."€"go.info.encoding/xml.begCommentgo.info.encoding/xml.endCommentgo.info.encoding/xml.endProcInstgo.info.encoding/xml.marshalerTypego.info.encoding/xml.marshalerAttrTypego.info.encoding/xml.textMarshalerTypego.info.encoding/xml.ddBytesgo.info.encoding/xml.attrTypego.info.encoding/xml.unmarshalerTypego.info.encoding/xml.unmarshalerAttrTypego.info.encoding/xml.textUnmarshalerTypego.constinfo.encoding/xmltype.sync.Mapgo.info.encoding/xml.tinfoMapgo.info.sync.Mapgo.info.encoding/xml.nameTypego.info.encoding/xml.errRawTokengo.info.encoding/xml.entitygo.info.map[string]int32encoding/xml..stmp_0type.*unicode.RangeTablego.info.encoding/xml.firstgo.info.*unicode.RangeTableencoding/xml..stmp_2go.info.encoding/xml.secondgo.info.encoding/xml.HTMLEntitygo.info.map[string]stringgo.info.encoding/xml.htmlEntityencoding/xml.HTMLAutoCloseencoding/xml..stmp_4go.info.encoding/xml.HTMLAutoCloseencoding/xml.htmlAutoClosego.info.encoding/xml.htmlAutoClosego.info.encoding/xml.escQuotgo.info.encoding/xml.escAposgo.info.encoding/xml.escAmpgo.info.encoding/xml.escLTgo.info.encoding/xml.escGTgo.info.encoding/xml.escTabgo.info.encoding/xml.escNLgo.info.encoding/xml.escCRgo.info.encoding/xml.escFFFDgo.info.encoding/xml.cdataStartgo.info.encoding/xml.cdataEndgo.info.encoding/xml.cdataEscapeencoding/xml..stmp_1type.unicode.RangeTablego.info.encoding/xml..stmp_0go.info.unicode.RangeTabletype.noalg.[190]unicode.Range16go.info.encoding/xml..stmp_1go.info.noalg.[190]unicode.Range16encoding/xml..stmp_3go.info.encoding/xml..stmp_2type.noalg.[112]unicode.Range16go.info.encoding/xml..stmp_3go.info.noalg.[112]unicode.Range16type.noalg.[13]stringgo.info.encoding/xml..stmp_4go.info.noalg.[13]stringtype.noalg.[252]stringtype..eqfunc.encoding/xml.Nameruntime.memequal64·fruntime.gcbits.01type..namedata.*xml.Name.type.*encoding/xml.Nameruntime.gcbits.05type..importpath.encoding/xml.type..namedata.Space.type..namedata.Local.type..eqfunc.encoding/xml.Attrtype..namedata.*xml.Attr.runtime.gcbits.15type..namedata.Name.type..namedata.Value.type..namedata.*xml.CharData.type..namedata.*func(*xml.CharData) xml.CharData-type.*func(*encoding/xml.CharData) encoding/xml.CharDatatype.func(*encoding/xml.CharData) encoding/xml.CharDatatype..namedata.Copy.type..namedata.*func() xml.CharData-type.*func() encoding/xml.CharDatatype.func() encoding/xml.CharDatatype..namedata.*func(xml.CharData) xml.CharData-type.*func(encoding/xml.CharData) encoding/xml.CharDatatype.func(encoding/xml.CharData) encoding/xml.CharDatatype..namedata.*xml.Comment.type..namedata.*func(*xml.Comment) xml.Comment-type.*func(*encoding/xml.Comment) encoding/xml.Commenttype.func(*encoding/xml.Comment) encoding/xml.Commenttype..namedata.*func() xml.Comment-type.*func() encoding/xml.Commenttype.func() encoding/xml.Commenttype..namedata.*func(xml.Comment) xml.Comment-type.*func(encoding/xml.Comment) encoding/xml.Commenttype.func(encoding/xml.Comment) encoding/xml.Commenttype..namedata.*[]string-type.*[]stringtype..namedata.*[]uint8-type.*[]uint8type..namedata.*[8]uint8-type.*[8]uint8type.[8]uint8runtime.gcbits.type..namedata.*[8]string-type.*[8]stringtype.noalg.[8]stringruntime.gcbits.5555type..namedata.*map.bucket[string]string-type.*map.bucket[string]stringtype.noalg.map.bucket[string]stringruntime.gcbits.aaaaaaaa02type..importpath..type..namedata.topbits-type..namedata.keys-type..namedata.elems-type..namedata.overflow-runtime.strhash·ftype..namedata.*map[string]string-type.*map[string]stringtype..namedata.*func(string, io.Reader) (io.Reader, error)-type.*func(string, io.Reader) (io.Reader, error)type.func(string, io.Reader) (io.Reader, error)runtime.nilinterequal·ftype..namedata.*xml.Token.type.*encoding/xml.Tokenruntime.gcbits.02type..namedata.*func() (xml.Token, error)-type.*func() (encoding/xml.Token, error)type.func() (encoding/xml.Token, error)runtime.interequal·ftype..namedata.*xml.TokenReader.type.*encoding/xml.TokenReadertype..namedata.Token.type..eqfunc.encoding/xml.stacktype..namedata.*xml.stack-type..namedata.next-type..namedata.kind-type..namedata.name-type..namedata.ok-type..namedata.*xml.Decoder.type..namedata.*interface {}-type.*interface {}type..namedata.*func(*xml.Decoder, interface {}) error-type.*func(*encoding/xml.Decoder, interface {}) errortype.func(*encoding/xml.Decoder, interface {}) errortype..namedata.*[]xml.Attr-type.*[]encoding/xml.Attrtype.[]encoding/xml.Attrtype..namedata.*xml.StartElement.type..namedata.*func(xml.StartElement) xml.StartElement-type.*func(encoding/xml.StartElement) encoding/xml.StartElementtype.func(encoding/xml.StartElement) encoding/xml.StartElementtype..eqfunc.encoding/xml.EndElementtype..namedata.*xml.EndElement.type.*encoding/xml.EndElementtype..namedata.*func(xml.StartElement) xml.EndElement-type.*func(encoding/xml.StartElement) encoding/xml.EndElementtype.func(encoding/xml.StartElement) encoding/xml.EndElementtype..namedata.Attr.type..namedata.*func() xml.StartElement-type.*func() encoding/xml.StartElementtype.func() encoding/xml.StartElementtype..namedata.End.type..namedata.*func() xml.EndElement-type.*func() encoding/xml.EndElementtype.func() encoding/xml.EndElementtype..namedata.*func(*xml.StartElement) xml.StartElement-type.*func(*encoding/xml.StartElement) encoding/xml.StartElementtype.func(*encoding/xml.StartElement) encoding/xml.StartElementtype..namedata.*func(*xml.StartElement) xml.EndElement-type.*func(*encoding/xml.StartElement) encoding/xml.EndElementtype.func(*encoding/xml.StartElement) encoding/xml.EndElementtype..namedata.*func(*xml.Decoder, interface {}, *xml.StartElement) error-type.*func(*encoding/xml.Decoder, interface {}, *encoding/xml.StartElement) errortype.func(*encoding/xml.Decoder, interface {}, *encoding/xml.StartElement) errortype..namedata.*func(*xml.Decoder) int64-type.*func(*encoding/xml.Decoder) int64type.func(*encoding/xml.Decoder) int64type..namedata.*func(*xml.Decoder) (xml.Token, error)-type.*func(*encoding/xml.Decoder) (encoding/xml.Token, error)type.func(*encoding/xml.Decoder) (encoding/xml.Token, error)type..namedata.*func(*xml.Decoder) error-type.*func(*encoding/xml.Decoder) errortype.func(*encoding/xml.Decoder) errortype..namedata.*func(*xml.Decoder) []uint8-type.*func(*encoding/xml.Decoder) []uint8type.func(*encoding/xml.Decoder) []uint8type..namedata.*func(*xml.Decoder, xml.Token) (xml.Token, bool)-type.*func(*encoding/xml.Decoder, encoding/xml.Token) (encoding/xml.Token, bool)type.func(*encoding/xml.Decoder, encoding/xml.Token) (encoding/xml.Token, bool)type..namedata.*func(*xml.Decoder) (uint8, bool)-type.*func(*encoding/xml.Decoder) (uint8, bool)type.func(*encoding/xml.Decoder) (uint8, bool)type..namedata.*func(*xml.Decoder) (string, bool)-type.*func(*encoding/xml.Decoder) (string, bool)type.func(*encoding/xml.Decoder) (string, bool)type..namedata.*func(*xml.Decoder) (xml.Name, bool)-type.*func(*encoding/xml.Decoder) (encoding/xml.Name, bool)type.func(*encoding/xml.Decoder) (encoding/xml.Name, bool)type..namedata.*func(*xml.Decoder) *xml.stack-type.*func(*encoding/xml.Decoder) *encoding/xml.stacktype.func(*encoding/xml.Decoder) *encoding/xml.stacktype..namedata.*func(*xml.Decoder) bool-type.*func(*encoding/xml.Decoder) booltype.func(*encoding/xml.Decoder) booltype..namedata.*func(*xml.Decoder, *xml.EndElement) bool-type.*func(*encoding/xml.Decoder, *encoding/xml.EndElement) booltype.func(*encoding/xml.Decoder, *encoding/xml.EndElement) booltype..namedata.*func(*xml.Decoder, int) *xml.stack-type.*func(*encoding/xml.Decoder, int) *encoding/xml.stacktype.func(*encoding/xml.Decoder, int) *encoding/xml.stacktype..namedata.*func(*xml.Decoder)-type.*func(*encoding/xml.Decoder)type.func(*encoding/xml.Decoder)type..namedata.*func(*xml.Decoder, xml.Name)-type.*func(*encoding/xml.Decoder, encoding/xml.Name)type.func(*encoding/xml.Decoder, encoding/xml.Name)type..namedata.*func(*xml.Decoder, string, string, bool)-type.*func(*encoding/xml.Decoder, string, string, bool)type.func(*encoding/xml.Decoder, string, string, bool)type..namedata.*func(*xml.Decoder) int-type.*func(*encoding/xml.Decoder) inttype.func(*encoding/xml.Decoder) inttype..namedata.*func(*xml.Decoder, io.Reader)-type.*func(*encoding/xml.Decoder, io.Reader)type.func(*encoding/xml.Decoder, io.Reader)type..namedata.*func(*xml.Decoder, string) error-type.*func(*encoding/xml.Decoder, string) errortype.func(*encoding/xml.Decoder, string) errortype..namedata.*func(*xml.Decoder, int, bool) []uint8-type.*func(*encoding/xml.Decoder, int, bool) []uint8type.func(*encoding/xml.Decoder, int, bool) []uint8type..namedata.*func(*xml.Decoder, *xml.Name, bool)-type.*func(*encoding/xml.Decoder, *encoding/xml.Name, bool)type.func(*encoding/xml.Decoder, *encoding/xml.Name, bool)type..namedata.*func(*xml.Decoder, uint8)-type.*func(*encoding/xml.Decoder, uint8)type.func(*encoding/xml.Decoder, uint8)type..namedata.*func(*xml.Decoder, reflect.Value, *xml.StartElement) error-type.*func(*encoding/xml.Decoder, reflect.Value, *encoding/xml.StartElement) errortype.func(*encoding/xml.Decoder, reflect.Value, *encoding/xml.StartElement) errortype..namedata.*func(*xml.Decoder, reflect.Value, xml.Attr) error-type.*func(*encoding/xml.Decoder, reflect.Value, encoding/xml.Attr) errortype.func(*encoding/xml.Decoder, reflect.Value, encoding/xml.Attr) errortype..namedata.*func(*xml.Decoder, xml.StartElement) error-type.*func(*encoding/xml.Decoder, encoding/xml.StartElement) errortype.func(*encoding/xml.Decoder, encoding/xml.StartElement) errortype..namedata.*xml.Unmarshaler.type..namedata.UnmarshalXML.type..namedata.*func(*xml.Decoder, xml.Unmarshaler, *xml.StartElement) error-type.*func(*encoding/xml.Decoder, encoding/xml.Unmarshaler, *encoding/xml.StartElement) errortype.func(*encoding/xml.Decoder, encoding/xml.Unmarshaler, *encoding/xml.StartElement) errortype..namedata.*[]int-type.*[]inttype.[]inttype..namedata.*xml.fieldFlags-type.*encoding/xml.fieldFlagstype.encoding/xml.fieldFlagsruntime.gcbits.2901type..namedata.*xml.fieldInfo-type..namedata.idx-type..namedata.xmlns-type..namedata.flags-type..namedata.parents-type..namedata.*func(*xml.fieldInfo, reflect.Value, bool) reflect.Value-type.*func(*encoding/xml.fieldInfo, reflect.Value, bool) reflect.Valuetype.func(*encoding/xml.fieldInfo, reflect.Value, bool) reflect.Valuetype..namedata.value-type..namedata.*func(reflect.Value, bool) reflect.Value-type.*func(reflect.Value, bool) reflect.Valuetype.func(reflect.Value, bool) reflect.Valuetype..namedata.*[]xml.fieldInfo-type.[]encoding/xml.fieldInforuntime.gcbits.03type..namedata.*xml.typeInfo-type..namedata.xmlname-type..namedata.fields-type..namedata.*func(*xml.Decoder, *xml.typeInfo, reflect.Value, []string, *xml.StartElement) (bool, error)-type.*func(*encoding/xml.Decoder, *encoding/xml.typeInfo, reflect.Value, []string, *encoding/xml.StartElement) (bool, error)type.func(*encoding/xml.Decoder, *encoding/xml.typeInfo, reflect.Value, []string, *encoding/xml.StartElement) (bool, error)type..namedata.*func(*xml.Decoder, encoding.TextUnmarshaler) error-type.*func(*encoding/xml.Decoder, encoding.TextUnmarshaler) errortype.func(*encoding/xml.Decoder, encoding.TextUnmarshaler) errortype..namedata.Decode.type..namedata.*func(interface {}) error-type.*func(interface {}) errortype.func(interface {}) errortype..namedata.DecodeElement.type..namedata.*func(interface {}, *xml.StartElement) error-type.*func(interface {}, *encoding/xml.StartElement) errortype.func(interface {}, *encoding/xml.StartElement) errortype..namedata.InputOffset.type..namedata.*func() int64-type.*func() int64type.func() int64type..namedata.RawToken.type..namedata.Skip.type..namedata.*func() error-type.*func() errortype.func() errortype..namedata.attrval-type..namedata.*func() []uint8-type.*func() []uint8type.func() []uint8type..namedata.autoClose-type..namedata.*func(xml.Token) (xml.Token, bool)-type.*func(encoding/xml.Token) (encoding/xml.Token, bool)type.func(encoding/xml.Token) (encoding/xml.Token, bool)type..namedata.getc-type..namedata.*func() (uint8, bool)-type.*func() (uint8, bool)type.func() (uint8, bool)type..namedata.mustgetc-type..namedata.*func() (string, bool)-type.*func() (string, bool)type.func() (string, bool)type..namedata.nsname-type..namedata.*func() (xml.Name, bool)-type.*func() (encoding/xml.Name, bool)type.func() (encoding/xml.Name, bool)type..namedata.pop-type..namedata.*func() *xml.stack-type.*func() *encoding/xml.stacktype.func() *encoding/xml.stacktype..namedata.popEOF-type..namedata.*func() bool-type.*func() booltype.func() booltype..namedata.popElement-type..namedata.*func(*xml.EndElement) bool-type.*func(*encoding/xml.EndElement) booltype.func(*encoding/xml.EndElement) booltype..namedata.push-type..namedata.*func(int) *xml.stack-type.*func(int) *encoding/xml.stacktype.func(int) *encoding/xml.stacktype..namedata.pushEOF-type..namedata.*func()-type.*func()type.func()type..namedata.pushElement-type..namedata.*func(xml.Name)-type.*func(encoding/xml.Name)type.func(encoding/xml.Name)type..namedata.pushNs-type..namedata.*func(string, string, bool)-type.*func(string, string, bool)type.func(string, string, bool)type..namedata.rawToken-type..namedata.readName-type..namedata.savedOffset-type..namedata.*func() int-type.*func() inttype.func() inttype..namedata.space-type..namedata.switchToReader-type..namedata.*func(io.Reader)-type.*func(io.Reader)type.func(io.Reader)type..namedata.syntaxError-type..namedata.*func(string) error-type.*func(string) errortype.func(string) errortype..namedata.text-type..namedata.*func(int, bool) []uint8-type.*func(int, bool) []uint8type.func(int, bool) []uint8type..namedata.translate-type..namedata.*func(*xml.Name, bool)-type.*func(*encoding/xml.Name, bool)type.func(*encoding/xml.Name, bool)type..namedata.ungetc-type..namedata.*func(uint8)-type.*func(uint8)type.func(uint8)type..namedata.unmarshal-type..namedata.*func(reflect.Value, *xml.StartElement) error-type.*func(reflect.Value, *encoding/xml.StartElement) errortype.func(reflect.Value, *encoding/xml.StartElement) errortype..namedata.unmarshalAttr-type..namedata.*func(reflect.Value, xml.Attr) error-type.*func(reflect.Value, encoding/xml.Attr) errortype.func(reflect.Value, encoding/xml.Attr) errortype..namedata.unmarshalInterface-type..namedata.*func(xml.Unmarshaler, *xml.StartElement) error-type.*func(encoding/xml.Unmarshaler, *encoding/xml.StartElement) errortype.func(encoding/xml.Unmarshaler, *encoding/xml.StartElement) errortype..namedata.unmarshalPath-type..namedata.*func(*xml.typeInfo, reflect.Value, []string, *xml.StartElement) (bool, error)-type.*func(*encoding/xml.typeInfo, reflect.Value, []string, *encoding/xml.StartElement) (bool, error)type.func(*encoding/xml.typeInfo, reflect.Value, []string, *encoding/xml.StartElement) (bool, error)type..namedata.unmarshalTextInterface-type..namedata.*func(encoding.TextUnmarshaler) error-type.*func(encoding.TextUnmarshaler) errortype.func(encoding.TextUnmarshaler) errorruntime.gcbits.721aae54type..namedata.Strict.type..namedata.AutoClose.type..namedata.Entity.type..namedata.CharsetReader.type..namedata.DefaultSpace.type..namedata.r-type..namedata.t-type..namedata.buf-type..namedata.saved-type..namedata.stk-type..namedata.free-type..namedata.needClose-type..namedata.toClose-type..namedata.nextToken-type..namedata.nextByte-type..namedata.ns-type..namedata.err-type..namedata.line-type..namedata.offset-type..namedata.unmarshalDepth-type..namedata.*xml.Directive.type..namedata.*func(*xml.Directive) xml.Directive-type.*func(*encoding/xml.Directive) encoding/xml.Directivetype.func(*encoding/xml.Directive) encoding/xml.Directivetype..namedata.*func() xml.Directive-type.*func() encoding/xml.Directivetype.func() encoding/xml.Directivetype..namedata.*func(xml.Directive) xml.Directive-type.*func(encoding/xml.Directive) encoding/xml.Directivetype.func(encoding/xml.Directive) encoding/xml.Directivetype..namedata.*xml.Encoder.type..namedata.*func(*xml.Encoder, interface {}) error-type.*func(*encoding/xml.Encoder, interface {}) errortype.func(*encoding/xml.Encoder, interface {}) errortype..namedata.*func(*xml.Encoder, interface {}, xml.StartElement) error-type.*func(*encoding/xml.Encoder, interface {}, encoding/xml.StartElement) errortype.func(*encoding/xml.Encoder, interface {}, encoding/xml.StartElement) errortype..namedata.*func(*xml.Encoder, xml.Token) error-type.*func(*encoding/xml.Encoder, encoding/xml.Token) errortype.func(*encoding/xml.Encoder, encoding/xml.Token) errortype..namedata.*func(*xml.Encoder) error-type.*func(*encoding/xml.Encoder) errortype.func(*encoding/xml.Encoder) errortype..namedata.*func(*xml.Encoder, string, string)-type.*func(*encoding/xml.Encoder, string, string)type.func(*encoding/xml.Encoder, string, string)type..namedata.Encode.type..namedata.EncodeElement.type..namedata.*func(interface {}, xml.StartElement) error-type.*func(interface {}, encoding/xml.StartElement) errortype.func(interface {}, encoding/xml.StartElement) errortype..namedata.EncodeToken.type..namedata.*func(xml.Token) error-type.*func(encoding/xml.Token) errortype.func(encoding/xml.Token) errortype..namedata.Flush.type..namedata.Indent.type..namedata.*func(string, string)-type.*func(string, string)type.func(string, string)type..namedata.*[]xml.Name-type.*[]encoding/xml.Nametype.[]encoding/xml.Nametype..namedata.*xml.printer-type..namedata.*func(*xml.printer) int-type.*func(*encoding/xml.printer) inttype.func(*encoding/xml.printer) inttype..namedata.*func(*xml.printer, string)-type.*func(*encoding/xml.printer, string)type.func(*encoding/xml.printer, string)type..namedata.*func(*xml.printer) error-type.*func(*encoding/xml.printer) errortype.func(*encoding/xml.printer) errortype..namedata.*func(*xml.printer, io.Reader) (int64, error)-type.*func(*encoding/xml.printer, io.Reader) (int64, error)type.func(*encoding/xml.printer, io.Reader) (int64, error)type..namedata.*func(*xml.printer, io.Writer)-type.*func(*encoding/xml.printer, io.Writer)type.func(*encoding/xml.printer, io.Writer)type..namedata.*func(*xml.printer, []uint8) (int, error)-type.*func(*encoding/xml.printer, []uint8) (int, error)type.func(*encoding/xml.printer, []uint8) (int, error)type..namedata.*func(*xml.printer, uint8) error-type.*func(*encoding/xml.printer, uint8) errortype.func(*encoding/xml.printer, uint8) errortype..namedata.*func(*xml.printer, int32) (int, error)-type.*func(*encoding/xml.printer, int32) (int, error)type.func(*encoding/xml.printer, int32) (int, error)type..namedata.*func(*xml.printer, string) (int, error)-type.*func(*encoding/xml.printer, string) (int, error)type.func(*encoding/xml.printer, string) (int, error)type..namedata.*func(*xml.printer, string) string-type.*func(*encoding/xml.printer, string) stringtype.func(*encoding/xml.printer, string) stringtype..namedata.*func(*xml.printer)-type.*func(*encoding/xml.printer)type.func(*encoding/xml.printer)type..namedata.*func(*xml.printer, *xml.StartElement, xml.Name, reflect.Value) error-type.*func(*encoding/xml.printer, *encoding/xml.StartElement, encoding/xml.Name, reflect.Value) errortype.func(*encoding/xml.printer, *encoding/xml.StartElement, encoding/xml.Name, reflect.Value) errortype..namedata.*func(*xml.Encoder, xml.StartElement) error-type.*func(*encoding/xml.Encoder, encoding/xml.StartElement) errortype.func(*encoding/xml.Encoder, encoding/xml.StartElement) errortype..namedata.*xml.Marshaler.type..namedata.MarshalXML.type..namedata.*func(*xml.printer, xml.Marshaler, xml.StartElement) error-type.*func(*encoding/xml.printer, encoding/xml.Marshaler, encoding/xml.StartElement) errortype.func(*encoding/xml.printer, encoding/xml.Marshaler, encoding/xml.StartElement) errortype..namedata.*func(*xml.printer, reflect.Type, reflect.Value) (string, []uint8, error)-type.*func(*encoding/xml.printer, reflect.Type, reflect.Value) (string, []uint8, error)type.func(*encoding/xml.printer, reflect.Type, reflect.Value) (string, []uint8, error)type..namedata.*func(*xml.printer, *xml.typeInfo, reflect.Value) error-type.*func(*encoding/xml.printer, *encoding/xml.typeInfo, reflect.Value) errortype.func(*encoding/xml.printer, *encoding/xml.typeInfo, reflect.Value) errortype..namedata.*func(*xml.printer, encoding.TextMarshaler, xml.StartElement) error-type.*func(*encoding/xml.printer, encoding.TextMarshaler, encoding/xml.StartElement) errortype.func(*encoding/xml.printer, encoding.TextMarshaler, encoding/xml.StartElement) errortype..namedata.*func(*xml.printer, reflect.Value, *xml.fieldInfo, *xml.StartElement) error-type.*func(*encoding/xml.printer, reflect.Value, *encoding/xml.fieldInfo, *encoding/xml.StartElement) errortype.func(*encoding/xml.printer, reflect.Value, *encoding/xml.fieldInfo, *encoding/xml.StartElement) errortype..namedata.*func(*xml.printer, xml.Name) error-type.*func(*encoding/xml.printer, encoding/xml.Name) errortype.func(*encoding/xml.printer, encoding/xml.Name) errortype..namedata.*func(*xml.printer, int)-type.*func(*encoding/xml.printer, int)type.func(*encoding/xml.printer, int)type..namedata.*func(*xml.printer, *xml.StartElement) error-type.*func(*encoding/xml.printer, *encoding/xml.StartElement) errortype.func(*encoding/xml.printer, *encoding/xml.StartElement) errortype..namedata.Available.type..namedata.Buffered.type..namedata.EscapeString.type..namedata.*func(string)-type.*func(string)type.func(string)type..namedata.ReadFrom.type..namedata.*func(io.Reader) (int64, error)-type.*func(io.Reader) (int64, error)type.func(io.Reader) (int64, error)type..namedata.Reset.type..namedata.*func(io.Writer)-type.*func(io.Writer)type.func(io.Writer)type..namedata.Size.type..namedata.Write.type..namedata.*func([]uint8) (int, error)-type.*func([]uint8) (int, error)type.func([]uint8) (int, error)type..namedata.WriteByte.type..namedata.*func(uint8) error-type.*func(uint8) errortype.func(uint8) errortype..namedata.WriteRune.type..namedata.*func(int32) (int, error)-type.*func(int32) (int, error)type.func(int32) (int, error)type..namedata.WriteString.type..namedata.*func(string) (int, error)-type.*func(string) (int, error)type.func(string) (int, error)type..namedata.cachedWriteError-type..namedata.createAttrPrefix-type..namedata.*func(string) string-type.*func(string) stringtype.func(string) stringtype..namedata.deleteAttrPrefix-type..namedata.markPrefix-type..namedata.marshalAttr-type..namedata.*func(*xml.StartElement, xml.Name, reflect.Value) error-type.*func(*encoding/xml.StartElement, encoding/xml.Name, reflect.Value) errortype.func(*encoding/xml.StartElement, encoding/xml.Name, reflect.Value) errortype..namedata.marshalInterface-type..namedata.*func(xml.Marshaler, xml.StartElement) error-type.*func(encoding/xml.Marshaler, encoding/xml.StartElement) errortype.func(encoding/xml.Marshaler, encoding/xml.StartElement) errortype..namedata.marshalSimple-type..namedata.*func(reflect.Type, reflect.Value) (string, []uint8, error)-type.*func(reflect.Type, reflect.Value) (string, []uint8, error)type.func(reflect.Type, reflect.Value) (string, []uint8, error)type..namedata.marshalStruct-type..namedata.*func(*xml.typeInfo, reflect.Value) error-type.*func(*encoding/xml.typeInfo, reflect.Value) errortype.func(*encoding/xml.typeInfo, reflect.Value) errortype..namedata.marshalTextInterface-type..namedata.*func(encoding.TextMarshaler, xml.StartElement) error-type.*func(encoding.TextMarshaler, encoding/xml.StartElement) errortype.func(encoding.TextMarshaler, encoding/xml.StartElement) errortype..namedata.marshalValue-type..namedata.*func(reflect.Value, *xml.fieldInfo, *xml.StartElement) error-type.*func(reflect.Value, *encoding/xml.fieldInfo, *encoding/xml.StartElement) errortype.func(reflect.Value, *encoding/xml.fieldInfo, *encoding/xml.StartElement) errortype..namedata.popPrefix-type..namedata.writeEnd-type..namedata.*func(xml.Name) error-type.*func(encoding/xml.Name) errortype.func(encoding/xml.Name) errortype..namedata.writeIndent-type..namedata.*func(int)-type.*func(int)type.func(int)type..namedata.writeStart-type..namedata.*func(*xml.StartElement) error-type.*func(*encoding/xml.StartElement) errortype.func(*encoding/xml.StartElement) errorruntime.gcbits.2b4etype..namedata.*func(xml.printer) int-type.*func(encoding/xml.printer) inttype.func(encoding/xml.printer) inttype..namedata.*func(xml.printer) error-type.*func(encoding/xml.printer) errortype.func(encoding/xml.printer) errortype..namedata.*func(xml.printer, io.Reader) (int64, error)-type.*func(encoding/xml.printer, io.Reader) (int64, error)type.func(encoding/xml.printer, io.Reader) (int64, error)type..namedata.*func(xml.printer, io.Writer)-type.*func(encoding/xml.printer, io.Writer)type.func(encoding/xml.printer, io.Writer)type..namedata.*func(xml.printer, []uint8) (int, error)-type.*func(encoding/xml.printer, []uint8) (int, error)type.func(encoding/xml.printer, []uint8) (int, error)type..namedata.*func(xml.printer, uint8) error-type.*func(encoding/xml.printer, uint8) errortype.func(encoding/xml.printer, uint8) errortype..namedata.*func(xml.printer, int32) (int, error)-type.*func(encoding/xml.printer, int32) (int, error)type.func(encoding/xml.printer, int32) (int, error)type..namedata.*func(xml.printer, string) (int, error)-type.*func(encoding/xml.printer, string) (int, error)type.func(encoding/xml.printer, string) (int, error)type..namedata.Writer.type..namedata.encoder-type..namedata.seq-type..namedata.indent-type..namedata.prefix-type..namedata.depth-type..namedata.indentedIn-type..namedata.putNewline-type..namedata.attrNS-type..namedata.attrPrefix-type..namedata.prefixes-type..namedata.tags-type..namedata.p-type..namedata.*func(xml.Name) (xml.Attr, error)-type.*func(encoding/xml.Name) (encoding/xml.Attr, error)type.func(encoding/xml.Name) (encoding/xml.Attr, error)type..namedata.*xml.MarshalerAttr.type..namedata.MarshalXMLAttr.type..namedata.*xml.ProcInst.type..namedata.*func(*xml.ProcInst) xml.ProcInst-type.*func(*encoding/xml.ProcInst) encoding/xml.ProcInsttype.func(*encoding/xml.ProcInst) encoding/xml.ProcInsttype..namedata.*func() xml.ProcInst-type.*func() encoding/xml.ProcInsttype.func() encoding/xml.ProcInsttype..namedata.*func(xml.ProcInst) xml.ProcInst-type.*func(encoding/xml.ProcInst) encoding/xml.ProcInsttype.func(encoding/xml.ProcInst) encoding/xml.ProcInsttype..namedata.Target.type..namedata.Inst.type..eqfunc.encoding/xml.SyntaxErrortype..namedata.*xml.SyntaxError.type..namedata.*func(*xml.SyntaxError) string-type.*func(*encoding/xml.SyntaxError) stringtype.func(*encoding/xml.SyntaxError) stringtype..namedata.Error.type..namedata.*func() string-type.*func() stringtype.func() stringtype..namedata.Msg.type..namedata.Line.type..eqfunc.encoding/xml.TagPathErrortype..namedata.*xml.TagPathError.type..namedata.*func(*xml.TagPathError) string-type.*func(*encoding/xml.TagPathError) stringtype.func(*encoding/xml.TagPathError) stringruntime.gcbits.5601type..namedata.Struct.type..namedata.Field1.type..namedata.Tag1.type..namedata.Field2.type..namedata.Tag2.runtime.strequal·ftype..namedata.*xml.UnmarshalError.type..namedata.*func(*xml.UnmarshalError) string-type.*func(*encoding/xml.UnmarshalError) stringtype.func(*encoding/xml.UnmarshalError) stringtype..namedata.*func(xml.UnmarshalError) string-type.*func(encoding/xml.UnmarshalError) stringtype.func(encoding/xml.UnmarshalError) stringtype..namedata.*func(xml.Attr) error-type.*func(encoding/xml.Attr) errortype.func(encoding/xml.Attr) errortype..namedata.*xml.UnmarshalerAttr.type..namedata.UnmarshalXMLAttr.type..namedata.*xml.UnsupportedTypeError.type..namedata.*func(*xml.UnsupportedTypeError) string-type.*func(*encoding/xml.UnsupportedTypeError) stringtype.func(*encoding/xml.UnsupportedTypeError) stringtype..namedata.Type.type..namedata.*xml.parentStack-type..namedata.*func(*xml.parentStack, []string) error-type.*func(*encoding/xml.parentStack, []string) errortype.func(*encoding/xml.parentStack, []string) errortype.*encoding/xml.parentStacktype..namedata.*func([]string) error-type.*func([]string) errortype.func([]string) errortype..namedata.trim-type.encoding/xml.parentStacktype..namedata.stack-type..namedata.**xml.stack-type..eqfunc64runtime.memequal_varlentype..namedata.*[64]uint8-type.*[64]uint8type..namedata.*[1]int-type.*[1]inttype..namedata.*[]interface {}-type.*[]interface {}type.[]interface {}type..namedata.*[1]interface {}-type.*[1]interface {}type..namedata.*[]reflect.Value-type.*[]reflect.Valuetype.[]reflect.Valuetype..eqfunc24type..namedata.*[1]reflect.Value-type.*[1]reflect.Valuetype..eqfunc.[2]interface {}type..namedata.*[2]interface {}-type.*[2]interface {}runtime.gcbits.0atype..eqfunc32type..namedata.*[32]uint8-type.*[32]uint8type..eqfunc.[3]interface {}type..namedata.*[3]interface {}-type.*[3]interface {}runtime.gcbits.2atype..eqfunc.[4]interface {}type..namedata.*[4]interface {}-type.*[4]interface {}runtime.gcbits.aaruntime.memequal32·ftype..namedata.*[4]uint8-type.*[4]uint8type..eqfunc.[5]interface {}type..namedata.*[5]interface {}-type.*[5]interface {}runtime.gcbits.aa02type..eqfunc.[8]stringtype..namedata.*func(io.Writer, []uint8) error-type.*func(io.Writer, []uint8) errortype.func(io.Writer, []uint8) errortype..namedata.*[]int32-type.*[]int32type.[]int32type..namedata.*[8]int32-type.*[8]int32type.noalg.[8]int32type..namedata.*map.bucket[string]int32-type.*map.bucket[string]int32type.noalg.map.bucket[string]int32runtime.gcbits.aaaa20type..namedata.*map[string]int32-type.*map[string]int32type..namedata.*[]unicode.Range16-type.*[]unicode.Range16type.[]unicode.Range16type.unicode.Range16type..namedata.*[112]unicode.Range16-type.*[112]unicode.Range16type..namedata.*[13]string-type.*[13]stringruntime.gcbits.55555501type..namedata.*[190]unicode.Range16-type.*[190]unicode.Range16type..namedata.*[252]string-type.*[252]stringruntime.gcbits.555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555555runtime.gcbits.6502bytes.(*Reader).Readbufio.(*Reader).ReadByteerrors.(*errorString).Errorreflect.(*rtype).Alignreflect.(*rtype).AssignableToreflect.(*rtype).Bitsreflect.(*rtype).ChanDirreflect.(*rtype).Comparablereflect.(*rtype).ConvertibleToreflect.(*rtype).Elemreflect.(*rtype).Fieldreflect.(*rtype).FieldAlignreflect.(*rtype).FieldByIndexreflect.(*rtype).FieldByNamereflect.(*rtype).FieldByNameFuncreflect.(*rtype).Implementsreflect.(*rtype).Inreflect.(*rtype).IsVariadicreflect.(*rtype).Keyreflect.(*rtype).Lenreflect.(*rtype).Methodreflect.(*rtype).MethodByNamereflect.(*rtype).Namereflect.(*rtype).NumFieldreflect.(*rtype).NumInreflect.(*rtype).NumMethodreflect.(*rtype).NumOutreflect.(*rtype).Outreflect.(*rtype).PkgPathreflect.(*rtype).Sizereflect.(*rtype).Stringreflect.(*rtype).commonreflect.(*rtype).uncommonstrconv.(*NumError).Errorbufio.(*Reader).Readtype..importpath.bufio.type..importpath.bytes.type..importpath.encoding.type..importpath.errors.type..importpath.fmt.type..importpath.io.type..importpath.reflect.type..importpath.strconv.type..importpath.strings.type..importpath.sync.type..importpath.unicode.type..importpath.unicode/utf8.gofile..$GOROOT/src/io/io.gogofile..$GOROOT/src/encoding/encoding.gogofile..$GOROOT/src/sync/map.gogofile..$GOROOT/src/sync/mutex.gogofile..$GOROOT/src/sync/atomic/value.gogofile..$GOROOT/src/unicode/letter.gogofile..$GOROOT/src/fmt/errors.gogofile..$GOROOT/src/strconv/atof.gogofile..$GOROOT/src/fmt/print.gogofile..$GOROOT/src/unicode/utf8/utf8.gogofile..$GOROOT/src/fmt/scan.gogofile..$GOROOT/src/errors/wrap.gogofile..$GOROOT/src/unicode/tables.gogofile..$GOROOT/src/math/const.go d q>3x( i
>B n # q3 v O~ y pw { !J~ f: b0 ρ F4 _[Z%W 2C E b nLl d i d { v n y f + ( + , \< ' " ( p $ # ( # J ! ( $ - % "
! A & : # ` # D' # # # + # 9 # b ( " % d ! 3 p m X D [ > % S #
S ( V ( G " - !
$ E # ( 5 , N " 8 % ` } $ P % ; [ (
j # - G% % * * ) * + m % )+ w ! 5. < * / . {2 % d3
! *- / 44 % `6 I5 ; = - @ ;
" JB j ! D D * TE ) E cF F 0G G WH 8 + VK 2 8 ! M & J * 1N 1 _1 ~1 # N MN , # M " L ! sL u S SL $ W e T 8T - # Z # B7 , TT + Y + U ] K tT j T
[ _ = g E $ a i Xb V c w w w w x x x y 'y >y Vy ny y y y y y p ! 6 $ K Y w u% w -5 3 3 % F
; ( ~5 S [ _ ` Ce ,e ϝ ` a ,a ea Sa ` ` a ?a nb b b 8 t I 8 g D 8 @ g D 8 @ >k D X & @ X k D X @ X D 8 H @ ` ѩ D 8 T @ h L0 @ 3P D 8 ۬ D 8 @ x ~ @ m D h d D 8 0 @ h D 8 1 @ @ R= @ ? D X /; @ : D 8 uJ D X &I @ @ n D X @ X O D c D 8 @ h D to @ , @ x c D 8 : @ h Dt D X
@ L D X L @ DA D X cA @ ! Hu D X
5 @ P " <d D 8 ! 3 @ h ' D X & @ x D h @ % ~ , e 8 * D
+ ~ / k 3 Q ' " P , x# , & 8 ' J) , u- 4/ 1 0 , 4 P ( 6 < 8 # a? P ! @ ) C H 8 $ M h ) YR ( >S ' X # ] e d d d M d d
d d @ d d d
h d d d d x d
r d d d ' d
3 d d d G d d
% d d d G d d
= d d p d d d
d d 0 d d d
d d 3 d d
T d d 0 d d 6 d
0 d d m d % d
* d d 3 d ! d
! d d @ d j d ? d
^ d d d d d
. d d d 8 d d
d d d Y d
d d d Y d
d d d L d ^ d
d d d d d
d d @ d d d
d d d > d d
d d d d d
d d d a d d
d d d # d
7 d d P d d y d
u d d d q d [ d
d d @ d C d G d
d d 3 d d
_ d d P d d q d
d d ! d ? d
d d m d d
7 d d d d d
d d 9 d d
V d d @ d d F d
d d d d d
7 d d @ d d d
d d ` d a d d
d d d E d
d
d d d d d
d d d ; d P d
\ d d @ d 3 d W d
d d d < d Y d
d d d ,
d d
T d d @ d d c d
d d g d d
7 d d @ d d d
d d 3 d ' d
W d d d d ' d
d d f d - d
x d d d 4 d
4 d d d
N d d d $ d
6 d d d ( d
Z d d d ( d
Z d d d 8 d
X d d d ( d
Z d d @ d [ d d
d d d d d
d d p d J d
^ d d d L
d E d
d d d U d
T d d d d d
d d d I d
@ d d f d = d
7 d d d Q d
3 d d P d f d F d
G d d @ d d O d
R d d @ d d Y d
g d d m d $ d
7 d d d d f d
d d @ d & d b d
d d 3 d , d
b d d
d d d
d d P d d d
d d @ d d : d
d d d O d
a d d 3 d d
X d d d 1 d
\ d d d C d
d d g d ! d
* d d d
d d
d d g d 6 d
* d d d i d e d
d d d d d
d d d d
d d 3 d ( d
. d d d o d
b d d d q d
h d d w d # d
7 d d 0 d d I d
( d d d = d d
d d @ d d 0 d
k d d 0 d $ d d
d d g d u d
x d d @ d d d
B d d d
H d d d
G d d d
D d d h d d
c d d d
B d d d
C d d h d d
a d d d
S d d h d d
g d d d
b d d d
< d d d d
[ d d d d
[ d d e d 5 d
h d d e d 5 d
g d d d
R d d d $ d
\ d d d = d
c d d 5 d 1 d
R d d d d
a d d 4 d d
k d d e d 5 d
i d d 4 d d
d d d d
E d d d
D d d d
A d d d d
c d d < d d
B d d d
@ d d d d
a d d 5 d d
S d d d d
g d d < d d
b d d ! d
h d d 8 d A d
h d d d d
b d d d d
c d d O d d
W d d d
d d d d $ d
Y d d d $ d
Y d d d $ d
Y d d d $ d
Y d d d - d
S w x x )x 9x Hx Yx gx xx x x x x < c &
4
-
M _ n { " " g%
.
.
7
m=
z= ]D pU xV V V FV #V
%c d d d d d Z| j| {| | | | | | | | | } } .} =} L} \} k} }} } } } } } } } ~ ~ #~ 5~ G~ Y~ k~ }~ ~ ~ ~ ~ ~ ~ ~ + ; M _ p - ? P ` r ɀ ۀ
1 C T d v ʁ ܁ ! 3 E W i z ͂ ނ # 3 B S c t à у " 1 @ Q b r Ƅ ׄ
& 4 G U d v Dž օ + = N _ p ņ ؆ ( 9 I Y i y ͇ އ
, = O ` p ˈ ڈ * ; I W f u ȉ ؉
. > N ] o Ŋ * : L \ k z ͋ ދ # 5 G Y k { Ō ӌ ' 5 G U c q ō Ӎ ' 5 C Q _ m { ώ ݎ # 1 ? M [ i w ˏ ُ - ; I W e s ǐ Ր
) 7 E S a o } Ñ ё ߑ % 3 A O ] k y ͒ ے ! / = K Y g u ɓ ד + 9 G U c q ǔ ֔ ! 0 ? N ] l { ƕ Օ / > M \ k z Ŗ Ԗ . = L [ j y ė ӗ - < K Z i x Ø Ҙ
$ 2 @ N \ n ș ڙ % 4 C R a p ǡ W ` M q T
T
/ * & 0 + O * " * ' + 1 ?( , p( 3 * * V. " T/ % : ! ;< # @ * @
A + ;C * kD H I % K & M * aO % P $ fP ( P ' P + R ) S ) X ( vZ & Z % Z , [ , 8[ ) d[ ' [ % ] ( D^ ' ^ % _ ) a_ _ " S` * e ) 7f & }f % g * h * !i j & k % uk ' k * l ) jm ' wn & t - u = X 1 g
[ < 0 = q 1 I A
= 2 & 0 $ @ 4 & A 5 ' ' % ! 0 e! $ < 0 \ ! P { { { | 1 Q& % 1 & # # ) + , D c0 8 e5
# 5 5 5 6 16
G6
" 9 8 7 > + B = 6 4 > ( 0 = $ M ?> A G lB ; % 8D L % Q Q Q Q Q 1 )| % * U ) GU ) T F V : F @W : ' W < W 0 1 U % ; U - XV ) T " >X . X " / W # : Y . + V\ . [ " , *\ \ % \ \
% \ ^ = |d 1 & 2V +] e e ء > h | 1 # N $ b 0 ɣ " f / ! # . >
c ) y ˧
" ; . - * # # = Q e y 7 ֪ ) v
! « 8 * 6 ( ( . & A 9 + 7 f ) J < ) 6 y ( ) ( + @ 2 1 # 2 $ 4 & . ( X 9 ˶ + 3 % # ) - 9 ! + ' ǹ . 7 1 # 6 J ( 4 & * K = B 4 ; ʾ - M Ŀ ? ` ~ H : 8 * K l ^ C F 5
) < . P
k
. t 2 $ 0 % D
& ( % " " _ + y % s
+ + A
0 E c
# ( - & * g = / 2 4 O & " ? 1 ^ P & 5 < '
= Y j {
+ = P d z 3 % % \ 2 $ i 7 ) I % ; 4
& ) 3 , % ; -
& ' < % R
' + ) = t / . & 9 + 0 Q " 7 ) 8 | * 2 $ # U G ; 2 - J ( < Y % K G + 9 S
E [ M 3 C % ( < \ . 6
N j
/ ! 8 M + ) " B )
* ) $ % E _
G z 9 \ < | . = K Z = $ 9 A + $ E 7 M ?
%
. & ( < d . - 8 * / 8 ! 6 ( 7 ] ) * = S i ~
1 # " 1 # $ 0 # " . / ! Y / z ! + A U k # 1 # 0 C " % $ 8 \ ) | 7 ) E Y 7 y ) % 7
> a ! 3
/ } !
$ ( ^ ! "
% t
%
4 a ?
' @ 0 E * ( A # I ' L ! - # . ) 5 ?8 QI 6 rK O f }
# 9 R * * * # ! * * * i
' * * * T ' * ; . ! * *
, n
* N
& x *
* * 1 * o * 1 * * * * $ * T x - * * * n , * G * q " * * A 1 ! * 5 ! * N * x * ! * ! 2 ) 5" * $# * N# . # * $
)% * & * & ; . '
* ( ) ( * ) ) q) * )
* n*
" * * N+ x+ * ^,
' , * K- . - * . *
/ * 0 * 0 3 ,1 * 2 7
3 * J4 & * t4 5 . 4 ! * 6 8 * 6 * 7
* -9 * W9 9 * H: * r: . : * ; * ; 8 *
? * 7? T % ? * b@ * A * A \ " A * B * B * C
* C
( C
* D ' D * qE & E * E F # }F " F * JG * tG # G $ H * mH * H D * I
* I * K * ,M * VM I * O * O / O * P , Q ' /Q , VQ * R * /R & * R * S * fS * S
* `X * X * "Z * LZ * ?] * i] * y^ * ^ * 7_ ` * u`
` * wa a - a * b
<b * b * b c * Cc * mc c
* Ze * f
) g * `g
& g * "h
& Lh * h
* ni
, i * i
# =j # j * j * k
$ >l * l * l * @m
) m * n . +n ! * n ! * #o ' Mo & o * o # p * Tp & ~p * p # p " $q * `q # q * q ' q * :r ' dr * r ) r * 's * Qs 2 {s * s * s * t + t * u 6 u ! v ! _v ! v ! w Lw d d d 4 d d d d d d L d & d d d d d . d d d d d d d d d d d : d d d
d d d : d d d
d F d d d d d ( d d d d d d d d d d d d d d d o d d ' d " d d d d d d d
d d d d d d
d d d d d d z d d d d d d f d d l d d B d b d
d d d d d d d d d d d d d d " d d d d d d R d
d d d + d d T d d d . d : d d d g d d * d d + d S d d d d x d d * d d d } d d d
d d d d d d B d d d d d d $ d d d
d d d d d d
d d d d d d d % d d d ] d d
d d d d d d d d d d d d d d d @ d ( d d d d d d d d d d d d
d d d n d % d % d d d d V d d d d A d r d d d d X d d b d d d : d d D d 1 d d 5 d d 7 d 0 d d d d d d d d & d d d d + d
d d
d $ d ) d A d d d d 9 d B d d d d d d d d d d d % d
d d d D d 5 d
d d d d d
d d 1 d y d d d d
d d d d d d
d d d d d d d d d d d d
d d d d d d d d d d d d d d d d d d d d d d d d d d d d , d d F d ( d d ( d
d
d @ d d d d d d d d d
d $ d d d d d d = d d d . d d d d
d
d . d d d d d d d d d d d d d d d d d , d d d d d d d d d d d " d d d d d d ) d d d d d d d d d d & d d d ; d G d ! d d d % d d d d d d d d d d
d _ d d d m d d # d d V d d d d d d d d d d d d & d d d d d d d d d d d d d d d d d d d d d d ^ d f d d d 2 d ] d d d d d d d ( d d d d d d 6 d d d d d d H d d d d d d d d . d d , d d d d . d d ( d d d d d d d d d d d d d d d d d d d d d d d d d d d d / d d D d d d d ) d d & d d d
d
d . d d L d : d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d
d d d d d d d d d d d d
d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d
d d d d d d d d d d d d d d d d d d d d d d d
d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d d ! e f `f f % .g g h % ! rh ! h % # Ki % i p #j zj j Yk k #l ! bl m m % m Yn ! n o c o c o p 7p p p q c Fq q r r ) r s H ! _t y " t v $ t Y - iu u Gv v v :w " yw # X " { " ^$ 0 # $ 1 $ $ ) $ 4 / ( / 0 ^ : ! * * ( , 3 z / 9 B 2 L < ! #A % & ,= 7 D@ $ / < + # $ & " i $ ; & " # + ' ( , & 2 " 9 @ $ ( M # ' ) * [ $ { > ( 3 - & " / G ) % 4 N : ( _ $ / jY 3 & Y " $ 7 ) Y - J $ K E & 0K 4 7 J O - O = , O2 1 / 2O S 2 kN ] 4 N D 0 1 B / 2 + . " : $ $: + 4 x7 9 , / /, 3 & =F + + F ' * G & , +H ( + G ' / %E 7
( ˚
(
) "
+ & ,
/ & R
/ x
%
& $
- ( ՛
1 (
1 K
& x
&
)
$
# ]
$ x
(
( "
+ " 9
+ [
% w
%
$
# Ȟ
#
$
#
# 1
% M
( l
&
) ԟ
% )
% {
%
%
% S q 8 ߢ E 8 7 E H " E 8 ! E @ 7 E 8 6 0 E H 6 E 8 5 E H ! ? E 8 ` E @ 5 E 8 4 E H 0 E 8
N{ E 8
V E 8 E 8 | E 8
E H E 8 Ϧ A H E 8 # = A E 8 ~ E X 0 i E 8 / E X Ȩ ( M E 8 ' u E H Ī E 8 A P 5
E 8 4 B E P E 8 E 8 ? E 8 > Z E H $ = . E 8 < k E H & E 8 % E @ $ g E 8 # E @ @ E 8 ? ' E H > E 8 = ۯ E H Q b E 8 P E X ' , E 8 & S E H = E 8 < E P ' Q E 8 & x E H ) ɲ E 8 ( E H P Z E 8 O E X / * E 8 . Y E P 0 E 8 / E P ; L E 8 : E P 5 E 8 4 $ E H & E 8 % E H @ E 8 ? D E P : E 8 9 E P ! L E 8 m E @ 4 E 8 3 E H 7 Z E 8 6 E X % E 8 $ E H , e E 8 + E H / E 8 . E P 4 E 8 3 E X ; E 8 : V E P ( E 8 ' E H R T E 8 Q E X I 9 E 8 H E X B E 8 A G E P ] E 8 \ n E X E 8
E 8 F E 8 E ` E X - E 8 , E P B E 8 k E 8 | O E 8 { E p A E 8 @ E P I E 8 g E H : E 8 9 E P E 8 E @ E 8 E @ M E 8 a E @ 9 E 8 8 E P i E 8 E H E 8 E H & M E 8 % s E H E 8 E @ > E 8 O E @ ) E 8 ( E H # . E 8 " Q E H E 8 E 8 E 8 E @ l E 8 E P E 8 ! E @ E 8 E @ E 8 E H U E 8 r E P $ E 8 # E H F E 8 W E @ ; E 8 : E P 2 E 8 1 E P F G E 8 E E P e M E 8 d E h * q E 8 ) E H : E 8 9 # E H # E 8 " E @ 9 E 8 8 1 E H 5 E 8 4 E P P n E 8 O E X ; A E 8 : | E P ' E 8 & E H 1 _ E 8 0 E P 9 . E 8 8 g E P $ E 8 # E H w E 8 E H E 8 E 8 % 9 E 8 $ ^ E H ) E 8 ( E H ' ' E 8 & N E H ; E 8 : E X , T E 8 + E H 7 E 8 6 E X . E 8 - E P 5 E 8 4 H E X 6 E 8 5 E X 0 Q E 8 / E P ! E 8 E @ e i E 8 d E ` B m E 8 A E P Z r E 8 Y E X W ~ E 8 V E h N r E 8 M E X Z ` E 8 Y E X k n E 8 j E ` : v E 8 9 E P & E 8 % 7 E H C E 8 B E P E 8 E @ $ E 8 # E P m E 8 E @ E 8
E P d E 8 { E H E 8 E P S E 8 r E P E 8
E H N E 8 M E X C E 8 B E P @ E 8 ? E ` 7 z E 8 6 E P C P E 8 B E P T > E 8 S E X # ; E 8 " ^ E H E 8 E @ , E 8 + F E H $ E 8 # E H & E 8 % ? E H : E 8 9 E X + @ E 8 * k E H 6 E 8 5 E X - g E 8 , E P 4 E 8 3 * E X 5 E 8 4 E X 8 P E 8 7 E P 8 M E 8 7 E H " E 8 ! E @ 7 S E 8 6 E H % , ] E 8 + E H E 8 E @ & 3 - E 8 , E H / E 8 . E H . s E 8 - E H # E 8 " E H 5 E 8 4 E H 5 E 8 4 E P \ E 8 v E H 1 E 8 % E H / E 8 U E 8 ; E H E 8 E 8 E 8 ^" E H E 8 E 8 % T E 8 4 E H j E 8 E H E 8 E H
?
E 8 ? E H e
E 8 r" E H
E 8
] E H ? E 8 ? E H g R E H $ E 8 # E P
E 8 E 8 = E 8 K A H E 8 " A E 8 [ E X 3
E 8 J
E 8
E 8 A H
E 8 A H E 8
A H P E 8 = A H % % E y + " ( # J d d M d d
d @ d d d
h b p d d d x d
r d d ' d
3 $ # d d G d d
% d d G d d
= ! "
d p d d d
, I e 8 d 0 d d d
d 3 d d
T ' & : # ` d 0 d d 6 d
0 d m d % d
* d 3 d ! d
! d @ d j d ? d
^ d d d d
. " d d 8 d d
. d d Y d
d d Y d
d d L d ^ d
d d d d
d @ d d d
# # d d > d d
O$ d d d d
# D' d d a d d
' & ' ' ' d d # d
7 d P d d y d
u d d q d [ d
! ( ) d @ d C d G d
d 3 d d
_ * D* d P d d q d
( + # + d ! d ? d
d m d d
7 $ - d d d d
- d 9 d d
V # . d @ d d F d
/ / 40 d d d d
7 1 d @ d d d
D3 d ` d a d d
d d E d
d
8 # 9 d d d d
9 9 d d ; d P d
\ d @ d 3 d W d
`; , \< d d < d Y d
< < < /> > d d ,
d d
T ? @ %@ d @ d d c d
d g d d
7 d @ d d d
=B d 3 d ' d
W " fC d d d ' d
d f d - d
x ! D d d 4 d
4 d d
N E d d $ d
6 d d ( d
Z d d ( d
Z d d 8 d
X d d ( d
Z d @ d [ d d
d d d d
J J d p d J d
^ K ;L M d d L
d E d
d d U d
T d d d d
d d I d
@ KP d f d = d
7 d d Q d
3 d P d f d F d
G d @ d d O d
R d @ d d Y d
g d m d $ d
7 d d d f d
R d @ d & d b d
d 3 d , d
b d
d d d
OY d P d d d
d @ d d : d
d d O d
a d 3 d d
X d d 1 d
\ d d C d
d g d ! d
* d d
d d
^ d g d 6 d
* d d i d e d
d d d d
d d d
d 3 d ( d
. d d o d
b d d q d
h d w d # d
7 d 0 d d I d
( a d d = d d
d @ d d 0 d
k d 0 d $ d d
d g d u d
x d @ d d d
B f d d
H d d
G d d
D d h d d
c d d
B d d
C d h d d
a d d
S d h d d
g d d
b d d
< d d d
[ `j d d d
[ j d e d 5 d
h d e d 5 d
g d d
R d d $ d
\ d d = d
c d 5 d 1 d
R d d d
a d 4 d d
k d e d 5 d
i d 4 d d
d d d
E d d
D d d
A d d d
c d < d d
B d d
@ d d d
a d 5 d d
S d d d
g d < d d
b d ! d
h d 8 d A d
h d d d
b d d d
c d O d d
W d d
d d d $ d
Y /v d d $ d
Y v d d $ d
Y v d d $ d
Y "w d d - d
S gw z z z { 5{ w{ { h М . " E " Ҡ % basefontbr area link img param hr input col frame isindex base meta <!-- --> <? ?> <! > xml / : _ xmlns: =" " xmlns="true false -- ( ) F , : and > version encodingutf-8 CDATA[ !-- = lt gt amp apos quot nbsp iexcl cent pound curren yen brvbar sect uml copy ordf laquo not shy reg macr deg plusmn sup2 sup3 acute micro para middot cedil sup1 ordm raquo frac14 frac12 frac34 iquest Agrave Aacute Acirc Atilde Auml Aring AElig Ccedil Egrave Eacute Ecirc Euml Igrave Iacute Icirc Iuml ETH Ntilde Ograve Oacute Ocirc Otilde Ouml times Oslash Ugrave Uacute Ucirc Uuml Yacute THORN szlig agrave aacute acirc atilde auml aring aelig ccedil egrave eacute ecirc euml igrave iacute icirc iuml eth ntilde ograve oacute ocirc otilde ouml divide oslash ugrave uacute ucirc uuml yacute thorn yuml fnof Alpha Beta Gamma Delta Epsilon Zeta Eta Theta Iota Kappa Lambda Mu Nu Xi Omicron Pi Rho Sigma Tau Upsilon Phi Chi Psi Omega alpha beta gamma delta epsilon zeta eta theta iota kappa lambda mu nu xi omicron pi rho sigmaf sigma tau upsilon phi chi psi omega thetasymupsih piv bull hellip prime Prime oline frasl weierp image real trade alefsym larr uarr rarr darr harr crarr lArr uArr rArr dArr hArr forall part exist empty nabla isin notin ni prod sum minus lowast radic prop infin ang and or cap cup int there4 sim cong asymp ne equiv le ge sub sup nsub sube supe oplus otimes perp sdot lceil rceil lfloor rfloor lang rang loz spades clubs hearts diams OElig oelig Scaron scaron Yuml circ tilde ensp emsp thinsp zwnj zwj lrm rlm ndash mdash lsquo rsquo sbquo ldquo rdquo bdquo dagger Dagger permil lsaquo rsaquo euro ¡ ¢ £ ¤ ¥ ¦ § ¨ © ª « ¬ ® ¯ ° ± ² ³ ´ µ ¶ · ¸ ¹ º » ¼ ½ ¾ ¿ À Á Â Ã Ä Å Æ Ç È É Ê Ë Ì Í Î Ï Ð Ñ Ò Ó Ô Õ Ö × Ø Ù Ú Û Ü Ý Þ ß à á â ã ä å æ ç è é ê ë ì í î ï ð ñ ò ó ô õ ö ÷ ø ù ú û ü ý þ ÿ ƒ Α Β Γ Δ Ε Ζ Η Θ Ι Κ Λ Μ Ν Ξ Ο Π Ρ Σ Τ Υ Φ Χ Ψ Ω α β γ δ ε ζ η θ ι κ λ μ ν ξ ο π ρ ς σ τ υ φ χ ψ ω ϑ ϒ ϖ • … ′ ″ ‾ ⁄ ℘ ℑ ℜ ™ ℵ ← ↑ → ↓ ↔ ↵ ⇐ ⇑ ⇒ ⇓ ⇔ ∀ ∂ ∃ ∅ ∇ ∈ ∉ ∋ ∏ ∑ − ∗ √ ∝ ∞ ∠ ∧ ∨ ∩ ∪ ∫ ∴ ∼ ≅ ≈ ≠ ≡ ≤ ≥ ⊂ ⊃ ⊄ ⊆ ⊇ ⊕ ⊗ ⊥ ⋅ ⌈ ⌉ ⌊ ⌋ 〈 〉 ◊ ♠ ♣ ♥ ♦ " & < Œ œ Š š Ÿ ˆ ˜ – — ‘ ’ ‚ “ ” „ † ‡ ‰ ‹ › € UU ) rT +N V
* UUU e w:z;]m; 9̉(kE){vSBY| ~Z}L9/I&LЉ
Mg]~[v3
)mt\l.@gKEU V+d?- ͝ "5rX;[dV 9 ^Rc nҙ"-kHr4SCH庾8)PachW^?
DzړWF) :Z$}kݵU ^JŖۭ.P Ň˧99ftnx(.^du.eF Eq,vʌxB7"'u
Zk>bw9 Cd"^Zvi@nHxNAa'ӪYB/SN%!Y>N"֙ND j~' a%"-9?ۯ %z^p
,-n `
ҽJi@nKtُFgI3Mk}_J^prçQMDe 6dؿW{Q^SoNNoBfػ@\B٫ZgBhw PY@H"oKy}iVIPsRdh}06= "˻W|/[\k/#Kn"Wͱ<] nLeGĵ#z <iQ46eI{Ծ 8q(Yeul>yJ2 Fr_A*iWx?2ҊłyԴjGm`K?Hc;xمc^ #HR9㲡͒Ȥ|.Ϸ7g+3|L)Kg;W{FfcBHIq7#Ե3-n 塼oaLi qxxܺ}nb52x7!=iOV7VБع4x/rK>rUlrSt'!˲TݏMvs |'07Xȧ8m vVlD'l-C`;+kWQ Aۯ4eg1؋:= C{
'u^bOf(F tt}J0 %qɹC \ۍ%oWm8kSǢZ{Vf-yܢ<䈊~1*Bwi IMVk."CJJ.90J\6S9ܪsB5/)z @?L r@Q<lKZݟCxMTQ ~вUW,mg'jw}zpi.FfԍJFz A?im]^`:-:"A=U)/m#+F' W 4 ׀~ %,d!Qعc ^$ۣq| 0$\S,r Dw Ip9S,r Dw Ip9_ ư~bgC < A;*\뇬Ȉ-ҷtނrPEW
oo9..[P6 1VOK k䞆=mn:J}U"@G FG&֗Ch+~!$R Wq,̥!$UWA ʨ6C }VG'x:i Uvm跾*9Cb²ĮЅTT5Q F-s62R9>\: >QRT?@b-)뀼*j[s4=0>8/#jB9mJ&WfZgI~
t11 @'
cK*UtVfO *NEX^1#Nvɖicr<\ <RaDJiL-fn8|*Jq.lz5 0- 5O:,H¾V}[F!`϶oFp_N`[k-* c* f9!*b|.̋E~ Ym$s
u&,?cy)qh`}!ٰxNS^ h8`۴Ճ] R#Q#Ѯ\뜵k rK '@
$î 8AWjM;r)gGs~zU_5|T<OK4h(ϡhWxT3trsw" ƌpoAs[P P0e
cP~$("ffUW ޘWzƄL ?@ZXZ&[3o{wjs.NSbVcxuȝ P }-n-< !% ֕| E 9\I"])Hi9N/oN|u-`_tdM,r# p: + (/E= x
Y*!#%aγ:@sw&'{-fA6R,UoYOU~:dPm+{(C/OEI*;?¶\0p_%VfI5{]d~nuYSfq B-f#Nc*O߫cIkcF| sƿ.ou~~a o,*41G =&5f;~.{:ЖF1YxRMLchN+vPYY
Uy%W"nv ̳!3&['vp4zOhѿb V}ɧ
ը+kIU84aU4)&ѣ/@
JWՕWvYGx ) Wr?w< L8m i V7B`=`]uVMofev'!5=4Ġʠy~C3Hv衎/a"X%D>9Qkzu@yw#=Q^KWMڝoR+\=@=|>a2 'a9ϥ7W]sIs.drjaRwͻ(puSfRl=F' 1 !>c20`X?b|έ) fa%+Uٸ X
ޭ6ϵ=*Y0|kI6jȤ̈JV%- I.⿋愥S\(GcfX7./87㴧
5LՒY!WxGv|jr (h e>(lS2} ;32CeA+: e/وlmEbV4ac 7֜]6vC N]>&z6 .6=yѲ
ETR.= WIMշQV ^ љ s[s 4Ԃk ZMə Pkf|h ~wR2jMv
C/`ǰϯǑ}FA 8%}uZ xjl2WNrYen#,5jc0 O&J bΝ OY5hmBZlEtfvQn m gJj˙#bWBI/eb5w.꿉{b\oy,W@0&, ^nx lUg1dCewb]i#l/V}}J i6e]TuơW\#W nh==ԫCy2 \0<lWz'z2q90:͕]SőƐY` ϑ<#ha:
c^cewusWs F5z`K$e4Վ .ŋE090r_ _]U
ڃ}nD8<97"QZ{z^qhE 12[" E9Nv<|`I^%:q$6^?[#Ɂ'y[셛#깾ːsժ bGɪ1< H_DtطҏRSѿ&cq]X@ȯ#0O<#B<BLɪ_5l5rbT=1@!h)tgCkכuR=DKRxVYjIb/XbPrRRPON㸲o
9)>J
Vn:D0a7jRѕ ^5qKܭ 7AkUl2߀^ ] R ]; C
6[F9T`뢨8zx IDfDȥ,.
10!9o\&7Jѝ { ɨ D*J02+1 KS8125[ЭTH'-nh )Cn%ɵt[6 Zr xTj& -dH'R~pMpLcz%1sJՈIQ!{#iA6\Rϧz 7q
'%.i"Ut>xKi 3rdO>U冚 b(ǣ>D_?hůTfIgӋ
PL}+o Z(qb=訴9W#o]LCƛ?FX(1N}\./]}]qu;§c 1ĎY(4<x-jkxhtaTp #;%FH!1a|(2W_&O ̺E t0m
VuliJ wپ tn fҌ2N,c$mn4,HUӢRH,
'`?NFȦV/6 D<|"k'ޔ9+-$\~t=(J(yX*$swHf ؏GtIeH y0jVʨny O|s}JNp?l-`l љ XEu51FN% aJ?TqRw gIfG+M |~<t
<p-`q= Y9zvۇqUfSdYRrz `R5ks zyrA~c.LӗlAэW$
cq|w(Gotst'q m vn+>pfhɕJxʊ8rJ1|^_. h$ɶMT VnCDz}smWf&N-q7u'E|=*J0/*q*;? 뭢Oo`I5[5\ rE
* N/Hcی
dVUK%zݼi kIZ ξ Edxrvj>ێPuMt(%.8|-1d=}Iaj(=! S!]P@s9ވ9 *k[o ş }yKP_ۖĤ>stΜ#?Ϭ
Bv}t}%c-+> &{[)V ?Lx1+ $+ m&>*|u5 )6 ɒEcG7ͧs
@(rJ~>ҿU^JT 4(sV& @5XM$EdB( )"7u >c}ZÍ;tmDZ( κ;8%nhi$?^y8éȞVq#/=he^M x<oQx V2۸-E2\P8h!8)~NBX V*=<GިvAwwMKls"+ґOK}
|QX
a;_7v5Iw>G@h @VJ{w>(t5"%(CEg~ l͍½5
ɞ_^25Cj}xo uW?&ܳSC[変'!4Ѻ ZI& E$:^6>PMEc-*?0p Z t0g@aBnwL@q]$^)XVMY\km$|{ KR]lMX'* DhV鶱[ǛwZjOob&ΫC䏉VERAbaL >¨nEQ=e/:a\{YHo&8qfGE ϙU{/tO)t~89GBIQQ6tN@هdAv\vXRT nq .oE+EӔAqf#dND* Үnřӏ9
zO
G]r$%{s)PU0"~o'.㫢4=8!1CaPG :{^~ 87S%x) |y
Phڡ /͋ރ
1,rcfQ=|>D_CL?dqN(h & #4P?::TcQxvVv$@]5,+ j 7t7;^qB
X qX}3;? Z`a'*Л^pԗן*S.d _|S͂ RSq#>.~D \,i o DmWECA8ⵚ1 ~ɹ"6Jcs<Kz$5B!R69K_: _G#D)G~HWφ":t dz6lD3sy_Ur]$P m|~HJVũPO&zֈSeߍ
ËW(`]ن%5=ӁD%.!i'="0]p3)KD% E> M(
a3|'p=M )/y p/)BQ_
P}0+DS4d_0Px*GnnZXc
`*zhJGɒc>2u4sە(e,sgUrx2 W7TXrd!@m]]x\Q Cϑ,92/К;)_6zo(~?C**
[ !,={t F qfocS0+*=)b]} {x- Q0 &6tiW2S3LNr@#eNiuh{"A?-t"ٕ4©F>a*1=즙x?JkN,Xۤfp(w+#YN&}*| u̼<gg9ا"=rA1?]]"gz"iT\(=.s.D[.OOU otUA'N.%$dm(5]<k#zuo:v<cX`l<zlm} a2Ě8Cނg9cq&1[}+A.ypAVZad1;!,D>V#1GC% CN!:k| :0;? 3G?J,K}f )H %8/㐜J\f6> hlk.Du_9h:a ۰/SCʬf{KeõjQFM KW|m+٨9 @| 1Yr8`tu f6j҉ X+~⢄،,
|ix$fc: AweI@b vpk%7@`NW9/'c
&)ffj @cL}g]aHRGC| ힹ W{8%)S F t` 0o֣d0^d2EOp# VHRkC/i^1go+Ś;+%q*ʠxFsV;ۍzo K*%ޑ)`_%$1lfdƲWx3VPŁ M j}]f<]F*G}ˇ&Ш<4> UK\K,jߍq!u5i/BE,ݎ8ɱ֥)K o~4 Q}V3;b7(" N3Udw;2rs{lI -` -jHq.6 ,H͞]6ԢN:+ufDL X:} *O
|DcmƭM7q72q%0clH7F R! PX p7כ$UzX%b w1jqĭvٔ3fҫW E=4#UW_%u5MޛלI#VohA.LO-զG*OPSs͡Y< * QTθ" -l^u ]=B<۞Au- Ҥ@l+R_؉ ) C <{6 n[ Gբ%"1J&_W"O
hy[?j
sq^,Vdn]M=k|{&]Rh_D@ y۸bW!n,9xjOe\{IMHi `!"2h4KSbnChpc}R1^u #QB%gCw=
-!#Кt( z ,bln=D-;
^V mrP0nOK7BW~Cޒr.З53W"W#tU~+5ްCWk8CG:AuuL 礙L|HyR5
$TN|nm|O7ޜ4Hel7XRB ސpPiDm/R4%qY>L37{z^p)7W]<Asx ㆨ+XWJlnm|O7ޜ4Hel7X4uQppX-^ ;?r N8#JlWh|č}
{bV> 5 TMi(^z&t(oCJn%VkQ)r4ʪnm|O7ޜ4Hel7XC谂Z=(8H-5nnlbHO.i,}%nm|O7ޜ4Hel7X۶R Ͻ$DdA{Y$5u?M5"V4Jus)pIDm$2YmIO
deX_}$ Pڍ
EXzA]נ_U8ˠ HN5g f4AErB[@O}eOMT4ci=bN˻m<J)e /ݑb[}Æ$ZCۙOR;4%qY>L37
Ǡ 9?tt$Z4%qY>L37CtbeJcNl6S;KʍWt} ͿYbâanI/fH
9?H T}f]v#țI 4e [\uYr|3`~][adWQ@iIҭ +@4TM4@ŻyTCr- !A/ U N8#JlWh|či$4y/nH& 0g^D=u vZ ,rBY zw5zu)6Έm0} =Ĺ c@r$cܱ cI
@*|8kL 6- =Ĺ c@r$cܱ _jk RPuj ojnt6}n1)lIӊ N8#JlWh|č+` F >KY2{#h2z 'IO˽7q$xUnm|O7ޜ4Hel7X{?wݸfh$btXwLT *ג
I:bC&7TΞY.gTqQ0S
;F6A
ַMO$btXwLT *_5S#5eځnm|O7ޜ4Hel7XnӘDH#H21M+)Ggl_\SoBWn *8V G\֮B`FfS-+S@[H~@jf
}SdXŅb
WcNt5/) zRmwM aɰ,lʅ9$G"Q@3i (cI6˾R^flEwm5gnK8(YE5Vo+q cV:8NL ;ZWycy C rфW3eLyƥѺH=h`z0cbVe 9@%ȳ1Qp@ 'qum/%MqNYJ#_[;M >{9;6T2 s YycC@lhR<J)e S dg*-t=i?@Z:5 ObrkQ^aqt=%;bv =,YΆW e0]iUrD1P`̻$$&7N!)5F&*A,X]flҠ@gg
%d tT ICmY,X]flҠ@gg
=fVcVAu]&[ N8#JlWh|č N8#JlWh|č N8#JlWh|čfWxAQpPx( r2+Ud惩MTJƵ3mc氉ܒE N8#JlWh|č5 ʁmm"krYuu M%$G w.bF^Lt\ /qW?>A]~#A-r+O f4Vo^Zv 1aN?1<(gy@l \y0.ACZNI
cm3Kelj:T'oltq
7^nm|O7ޜ4Hel7XSE7vL'3X2ki %ObD4e [\uYrhĒ\HXn r3nm|O7ޜ4Hel7Xa,=붢b&@Q Ӵ_c. b$w ߒN+Lbd_[o YQ7`"Wnm|O7ޜ4Hel7X4 M{6(@Tt<5 h P+$`,I/#祦1DC7\A" ʇ7 {-QY/7#.WlzH5W&\wCH?4TQ9DV82B><!h"R& %Q#s/@>e+r r7ۅlVYhg N8#JlWh|č4A m/1<||?iP"dEZkVx=)2v҂l 6)F֘tZ0[ S>~nm|O7ޜ4Hel7X(ʓ]/gVФ"dEZkVx=un~0-*%n=,)4t~J"dEZkVx=՞} qjWL 3|0%G^"g݅F|EفZ>]!.d
Ɂ]!&.4ȅ#$ !nm|O7ޜ4Hel7Xιv&v\;UHmnm|O7ޜ4Hel7X BJrD:kڲfu =Ĺ c@r$cܱ N_)V, vTۣ=xu5~)T nm|O7ޜ4Hel7Xx 6PU|I3Jgr_۩-L:uc3Jgr_۩-L:uchA.M{@OVsW|Rdd 6ohU3Jgr_۩-L:ucRti7Qm܂:+AY
1x=Ŷdgx+(3Jgr_۩-L:uc HH[L:O.U9sU/0>;'+4r/0>;'+4r'buZA 2 zgh|} zgh|} 8c:8 zgh|}1j0X#DSJގd-= ֓hD{
NSfSJގd-= zgh|}Ƕeg<$d8/SJގd-= 뀐;e ~^SJގd-= M%yQ<TR|w SJގd-= 57usm]374SJގd-= oc?/ONOXY1fE%ut)wf4%[A (
xyjF:e=$ 9 ]Gt^ '|y=*|kr0` ;힕3Jgr_۩-L:uc3Jgr_۩-L:ucM$` M] 4E*,RuzT̮f믰3Jgr_۩-L:uc3Jgr_۩-L:uc3Jgr_۩-L:uc3Jgr_۩-L:uc3Jgr_۩-L:ucSS>-{[TF̷w4!0Έ+{+PÌ 9gmC!]Pcf#ٓ$[pfO*A
JAQI8B\N=k,ub*WwD▇O\ McH+y"ʙ1O`} {cŊkɂc/ ?a`\Ɉ*]O)xL"Aifaᛚp y0qն
>:Nu-a {W{ŖtĠItƹu8Iq5!0πL} !T7ýll/L4PbfɵGs5[cwGŚF
CVcW8_fb L]/yjT@]] zm>M#d4`c ]C~N[)ZFDౚW-
t7 %chszUm'!89m OJ `L}fbŐġ#7fuX¦Mjقc.RcziQjzf uv{zYүӡ٢=Jn~G.\E qT56kzckD<ޣ}H2däe! S-ހt"jh5r$m( N& }˿+If^GyEq(3j'{).s]iMy rX?fCoP"4]1Y Վ+ًw?i$*, $4N 5V20{ Y~ɵE/& qL< >@uJNŖ:hp sٛlt(fQg3c¨b[pcc0S>+EFLN;xEXTOCr"xV)86SIOzb@S=
phQ9{ cV+4jE'6-]@+KyP~2*A#}sg.5<|e?kQh:7*r% |̪gJ8C#~I3$1F.l_19^RmÕ %M dqu&Cԏڝ݈|/}$sa3 xQQC`#>;>Q?SSHQS=\g4~Gn<7 +E@$ sD M?[͇8M̔q1E yA\KeI͌ o7ոJtgD
5i}r_ͪƣcŀ
zƏlCvE2ډY2`A UǎfCƠ,TqLɝl R \ֆÉB.p mkz-'D6<CSca\c2JܘwǃUuJȵeKd [trvmNNAϬΒt/ur@1Y)V[?0~EޑVwMy~v)bT&0\ ĚD)?.aPG:kJ9$2١ 3rvL@.r姃3 8a M}iպl?[
aFU(w0=H8WF}H]N[X%c՝ ɲ9a[x Ã`
<>{u[;NF2O?$RPM1䢷I/I^އ-!;$('WcCIBQ> s+ טLӛGSTb"{ G=\1i I7
>́;ϊ۶4U@t{"3r=N9Pk DGSPtbwUWf`y#<p Rx$#|=s̩bgʌ
y:ZС 3]p8b6ftl?aTXO53Lm)iuQԱ\ eۍS%~Dž3g :>q# CZ;cީYšXٖ3=c*&ǛkFDgHYV+{=wH}C]F0v?̕)օ;su|xU4k~Z7$Qoe ^ǻgܨ
]YUDNÓfu"xݷdDy½qD9-X_概 rT1Mcu%UY,lgEA"iR8AsA/w!J?O1F@bl;×ϔco0 }t '
$(E&BL9g|SxיtBD MBAf%p,BS6: whw A_`T -i@<m 1wЀ;6ʅZE͎ w }FvXG2lx7¹;,فLG
^ۄib3aInV?+
߱S~ `d7\;+fS"tɚ&Ks
zatJ1NB{Rs`Q2
v$>d&q] `1fx(;vt(ˠQPqS%kcOao獬>(sBFo0EkS{9dsCÇP7Jf(
>&ߌ{bT(݅~7 5f)̀iN䏽(mpE/4 t\"aSP8\^Ԇr"'!j! '܅ ſzy \ fq/By:Q6rk ݙؖX=͕*z<Su4ͥ m;,EAwR` teTXucԾaEy}'*i5gZJc5$~Mbˠrji_?^8Ot34;<2'<5U nv\X1X rqN MzP--wG`dN85/`GPB>.&|+3` weXU>Pk?wϓ q9a!Uӑ=Ҍ\ #ǝh}jOvphDdE
wIw[ %
ipYnca₰ԭEqΡL2>l{e'\?))xؽDu
F j 8E啋)bm L_cdzfЄ=?CΣ
οW#q @<r[|!ߠ,ے m+i| KG] )TU/
1ՙi뇰ߠ>j*8U/Oj<h:0n88|Lۗ_yn}D)Z쿟 0$'To:Md2/ ގgˢ$ԑq8-}omx +FÌro`"p@?l e ī![L7Wس`,b7㐸'`;e?x]&; )( Tcy a~=1r )'شdo<ËkI 4ا'9OH'wߴf.t<$9b o߳Mc {LcFLR֥t|{"y ݏYs=ߜ63~v5;]F+ƂR}
>%5mC
-44jC/2:wޙ>),l_iJUYrڌ *&;ڡ>IAX3 ^Q$ᲅ{G(u 7KZ dgd hI>^Ee
O ?E~d?^ T߉ z.R.4Er17#FqJ JsYon=Sؾ=^E@)
tiSE0HoxkƪBA
s܁R )Lr,~}mBFQL @fwB+4kU{~z .#c3G}U=Ȭ:`
g< JV"PA{l٨X֦g@{ *ϥ=˾yH2S )g\V?Q}DO(y
?y;ϪL`!i[T~E K
I |z (Te9jPhk09l GV8{,,{j=`9mtI'C*u m wEj9t>^ayI!j"SP}$xL
F `dP9Ā
&F0/{=DKN؉E:K# B6vn3sqZ]S .?9UKxq ߛ-
TX[a VBo&T7~:ƓtRTܣY* F_{~7)%HÔfO&WfDP> mb=_F$w#Y?$*HՑ(Vs?{0/)B@aG7وԔm; ̟/KLݕ"ʅê3]`{JzιFAW4aB L?? ourzM[1m9N)B0$o&!\FxTiIwc^MD|]Qv}=N@yB-$B3d `:zr3EL(DD@Bi TU /h>ѫ}IhCc_wU_`pPv3 6ش| > h^nSmqL"2`A^ˤ˔h^0OF\led ρ`B2 O]ByHe)-|wgק: ߹by
b TH:
4 3 TPVd/`o8wt~8ݟR$;}Op KtE/`b#zU;=7{B6PM(coSR^"5=p(:dEp[u8է!WT*2+ֳ)%!KWN\r ԚC.tt8<^&oYѩ0́b\ IdZfj%jjPMSԮQveATvR>)+H?Ği]6A.Fby?`a$뜵 ^ocB YհS7e%CW<j$ r}jsyL
j4!P 9! չ0L_dFc&VU~Ķ=X'V-繣pͯE:JN*n Dg҄*
.0ҧB+, -ObeTCl.4E 5OLGPi(,a `r1T_ Eq&kE}lM'ٺ3m`
n#*"эD1)8B RAe2rc^Ȇ%Nj(/oa~QU(0 =i夳=+ PjiӋ&$H6dodX
SgV!lFO4bVlPfE<u?XY) lp;ጜI۬Q7Jd!CE5'iu9귋VntJ/>J70mJS,siŧs0
I[` Ag3K]\Ň`r'Ha]7K7| 4WIQ%[ 1^}tţ)EdF5;ч>C C;k[)@>v^CWIF]`'- ~:bfEYyN DiE;|G |G<}
b<Q1I=:q8 qaK:ۭ璆>\oI|)e{܊J1ĕx? >" |E'/^-N J\Cfvx.(f) 'i!9 #:e}-$`ۄIW>\oI|)e{܊J1ĕx? >" D v ~T0rpp.v M_>iil xx 'i!9 #:e}-$`ۄIW>\oI|)e{܊J1ĕx? >" izSVs'GZq 3Av M_>iil xx 'i!9 #:e}-$`ۄIWgԆ3/c8tL>h* ey)< ,D;-oToB KԛvWc: ,lK?^`;k?*(T<#
-/fI>\oI|)e{܊J1ĕx? >" U0;Qe <v M_>iil xx 'i!9 #:e}-$`ۄIW0n]zې>!f B Wa HT5,k' |S@B"fIt"M{ c4vrhs-8y} j w]_b|~YE\wBitvPW>#E 8;f>t
,cLJꑠ[ szY]ڣuBq?/cx}E_tt'6e Q@Ř ѽZjڀJM~gY|) %<V.~\^bߢ!pǘi(׃/S2
777k& <D鑖k/}@,JmQDGeUQ9'zlEGsa e
P;g'NH_ExN$Bo,H- L~\BYۦށ|Z4g *q CVlI;<kx6bhx Ҽb BΠ! 8K¹<\6p6bܙ{o:* ;Ϸ:]5U nv\X1X u=@sf7(V<T*
H w3b
>w4=cɢ\1x Ϡ3r>;(ey KnM GW¥
|r`$+Ζ[r7RA({ N!ļĥD :yӬGLt(_6=/rFqNaVȎ\E*x#@Ve̮> (م]"V]kB -kVeӍ 瓆's;v>W=O*OeӫAk^6&-;s3p.|w S-~G Vm݊-|S??oavACGqT?hnijs-S FAG$Y:|:+O?@P>Y?;<hHxrLt*$^lV"b)hw0b-&Y}lB
hO %>X%3k2}g EҪ!e/1ZjƾyUzw\
/xj 7 | qB] T8G) C'\WFtvt4 3gNbU` v؛{K &ǭ+rhhtlP5A
y
{ ~~ߏѵH+--)Le$ ƴVp f*)(G]bde\.8X&=h
uWVcEitPDa$s
夎+M,'ӜT~
`2#1bi u }QKў.}H/$zZj҂ (tXW|M=pc {6 |y<uc⃔eWZԇSQ* eNlsgI ]WV, B9^ d-9=G~wr[l>
i-/[BsmmfYR 4EI# Dߦ٭碢麐_Dt5<L$ P)D#J<i<w|˓K ߎ NڔlŸOa o [bG\j9DpӉ$>ZQ2#ݳ`eJj} 螢Z49Ot% (HdIcJm4[`O?b1;D;
WգFVj}Ey&vyL0e&uqϴ) vAE_Uu3Z?3 ]0
U<{_;a mnpؤA+;?Gm!}f^(+ҨC9Gh<N<8 F HAL e@c[ 3̗V KaR<Kx[Y-~&ji!e <P
_Ohj 1O|wPUו-+`:$N&X'Lq7`ՆB9`ɳw-!MmʈhYV^/B6 9 cJGMzA CΛSM$"ig"=]A
zrR GO.A
;m"7OBҾR]B[ֽQ*tHYD(»K)?RhD*K1 6bsf $ej 9GҳZ-'v%oPy`mCSu4ͥ m;,EŐJHg9Lc=_gSP0 ;eD<c9L PS_a8Ⱦ~ޠE!iM+[pмС|
>3'
yCG祂]6d#T#r0ɼ֛ 3uMl}}z8cPy 9
xpB)8K$[^(#$x=d@D\/,m ]dp:sYV<pg [u Sn ]Tиn9 gN 'qY c3vzmnSCXji
}ť2ʅ<
X=A
4~5bT$tS; jf5v(-r裟 ىV|>y{t<Q9b lc*Rz+7 2z5z|@L8ҩwFjsң k A{2_$5NWE~7$. g M3#~p]_%&Գ:E{Y \ wlMwrN(lNtl, }pzGLJIcuS)d'E2_ 'GoS~ ?aX8[2 ೳr ֊9̔KB+&OLC)}D߃ǠƟz +ՒKݒҺtd_ֻ?Z bFu!6XT < \1b4&$<S>
7 2`36L!B`ge( S H'J9m5)793ȈcM?
іcGZ6%p+E^lDN! 8K¹<\6p6ʦ @r; c}_iy~m^ 3GAg8qMEր Dv[ ұQ<qeT)a~s|
+yɄ.xQA'IM K ; g1"{!+X1 [*4|a>dz2 OPOvv8[~ܤnPnyJ-̂:V17pj1] &Jwܓ i "tfoЄ~ dq% #q5Z簅VƤje!#\6jѽ4l"%iF?K(m?O1_/2`= msYA(Y^<
5clvth eNaEOI`U}uĹf-{x1fx ! \l*{( }1<U^ p1-4
dPS ftv[! @C"M_ x.( w%eWsu P{NV2/ s~vv'ksRe[(Jtt *B:\Ow}Xq2o,뎽dНD>` p ֲPj>%=ĸQ C"s[~7> &δS<Q \D+ti
,pClHN};LL| 9^V4?w;uxm3{=(ӱ(8lLei!\9DcfSvfZ4Nd E̮ b³Tyw.>
d<m 1o ;m
4*Hܻ & 5^=fcd, {s|XK3xMĢx=# oGsyUf*tq9QzD5Ugf 0y ~=G`A,qmB l D%
1ͤx5,o3ȱT,Tf'UQKOBTac1obgxOdP#lqjP(ӛ@ ۞AUao+_2fcQtp̸Cm;P{ m ٸ>tGbLw\f n[m Hx#ibXis3WѦ̩E1]}PMSԮQvePMSԮQvej eJ!A e?_'\Ωa$뜵 ^ҮPMSԮQvePMSԮQvej eJ!A e?_'\Ωa$뜵 ^һíh E#Í!Mj#díh E#Í!Mj#dM'mw{'^Fo>e27Chߑ~zPd~ H% $Oڽd~ H% $Oڽ[I
r}kXx,H <'4$_j6(<c9L PS_a<c9L PS_ak q} n
Nu
>3'
yCG祮PMSԮQvePMSԮQvej eJ!A e?_'\Ωa$뜵 ^d~ H% $Oڽd~ H% $Oڽ[I
r}kXx,H <'4$_j6(íh E#Í!Mj#díh E#Í!Mj#dM'mw{'^Fo>e27Chߑ~zPd~ H% $Oڽd~ H% $Oڽ[I
r}kXx,H <'4$_j6(d~ H% $Oڽd~ H% $Oڽ[I
r}kXx,H <'4$_j6( M0WZ
7 dDء ᢼ51K} f 5fC`|(rzPmB"Vqlo _U˫+o\r wۆLZ5yNEF
2dkܶEKy0z Uߖr9 ޝr8WSq4
d
.aPv랣M_IJ 寪zAFĵpl&qǢ8HY!)O!b(G:م/ӯfdݚ,ǦM|Q3W&{+/~l/"]zXfHE\"UXވ) B6;e] ޱi /^YMzebf`?E p6LKawg!z^ =s=x#)%Yο)AY64]I >t(_ cIy he]7=Jӻhݭ^YMzebf`?E p6LKaw
aj~Jh1ϖ_ @ο)AY64]I >t(_ cIy he]7=JӻhI!vD`T! ^_!K6P%bY_u6 RZ }o9-ZH8 /z_ Y ^)
G FT(ī3.='D>"58pSJr3U#Ϗ>R5N :EB3с9
bP]}Hp>~r;b,[EΖ3FII ցHx3II.:zc1re#E`%g[} /dBQ5
!֎LgZ1ݑDџGorւ3uc|crMo!v}H)0/] E'Z. L&4nWVEQN߀
*\»Bg,fS:-ɗZT(e DN?TgX-ԁYliW 7Yq7v饫sLWjmSHp ' 3K
X?ĚV3jboH#* "71-g_Xw&:CT] *"pn n1ng"Z`ƋRRa١ &Fy<tp
hr벡G>.8Q d Uv-=8ĭv6VKAțǓuk_# ݁V`_˜ HCM8U$ NbA!*`XeY@^YMzebf`?E p6LKawƧ2z8s+3A ο)AY64]I >t(_ cIy he]7=Jӻh݁벡G>.8Q d Uv-=8ĭv6VKAțǓuk_# ݁V`_˜ HCM8U$ NbA!*`XeY@|^̵ rc `%b*O[4j~^imL\!: onZv5"@.p R=<Y*C>
ÈuQѠ)+6 j/J:c |^̵ rc `%b*O[4j~^imL\!: onZv5"@.p R=<Y*C>
ÈuQѠ)+6 j/J:c M0WZ
7 dDء ᢼ51K} f 5fC`|(rzPmB"Vqlo _U˫+o\rیh<! 9L/ORf{Fiɻj[C,0Q5s=Ms ./6s
ypJSi_iژӌ^De o w} <ΠLj OF8F!u]nMubk M0WZ
7 dDء ᢼ51K} f 5fC`|(rzPmB"Vqlo _U˫+o\rL3i$+7!$Rb j,|^̵ rc `%b*O[4j~^imL\!: onZv5"@.p R=<Y*C>
ÈuQѠ)+6 j/J:c R!-Ϩ{ђ 'P<tu 8;e.g6
< sp&ƷF4 > ͮ(J0x5kH#V>"DjJ7uKɸ #*y+%/>ۙT4M:} M7C-m?ޅPSb|88P2Fsuƶ]/;aItXSHYUUd>'=tiL˨KpRawa9#.A5nD R<U] ]oœ9 } r?EOi;r^ v_Ľsn<å%]wq칊? BORf{Fiɻj[C,0Q5s=Ms ./6s
ypJSi_iژӌ^De o w} <ΠLj OF8F!u]nMubk\mϻSl| w2Շ,>7\?u4E`7mU 5GfW" @ 7%`NX ꬾ%9fGQ
ؤ?Z='+cDzY}!aB 1k+Yrvm*pwt: a7CT8"<<eNN40^%uv8TGw/dp- -Wmw͒I{i ▛OIɼj;@5*)r;y$hj p}2+Pk35:AB!f5Dԫ|OPvkb 4Q0>ZU[ ENoOݛԾin2jHy&%|</tu
}-r84._g~5>VoZA)CFTC}Q%%e
c<v^J~PWQ['E܅CR8\.rb~i̕ҷ xʔ\Yq7v饫sLWjmaPW%Irp%!D B3M!gkQUO8{
[C,0Q5s=Ms ./6s
ypJSi_iژӌ^De o w} <ΠLj [=d2I!\)loTI- }pLM/t }غ
J"r 3Ӷ҈D,vΜ"Bʍ9{%U|FOGW6=v"LLؑ8+fDK\)loTI- }pLM/t }غ
J"r 3Ӷ҈D,vΜ"Bʍ9{%U|FOGW6=v"LLؑ8+fDK\)loTI- }pLM/t }غ
J"r 3Ӷ҈D,vΜ"Bʍ9{%U|FOGW6=v"LLؑ8+fDK\)loTI- }pLM/t }غ
J"r 3Ӷ҈D,vΜ"Bʍ9{%U|FOGW6=v"LLؑ8+fDK@ +G $_ͦ\q &UKدZShv/мRàtT) ͽ k%
\<)hc !Ҙ%!sJ*L)!ž . > D N X ^ 1 _ # ) 3 9 F P S b b o
Q g o D U k q w w { 1 = Q [ b k r B B J Z ` ` k v y r
r
r
r
r
r
r
r
r
r
r
r
r
r
r
r
r
}
~
# 4 A E N R W g p z ~ 5 > G ` d m
$
(
1
:
G
P
Z
c
s
|
" " & 4 5 g g i n o N N Q Z [ x x y z 6 6 : ; I I L M Z Z \ c d z z | , , R N N P Q Z Z [ ^ _ h h j o p + + , - 3 3 4 7 8 K K N Y Z J ~ ~
! ! * < = z z ) * i i j k r r u ~
3 4 o o s t ' ' , 8 9 c c d h i | | } ~
* * , - 4 4 C j k
& & ( . / H H Q R s s t u | | 8 8 < = K K L T U ! ! ! ! ! ! ! ! #! #! &! '! 5! 5! 6! =! =! @! A! I! I! K! L! W! W! X! Y! `! `! c! d! l! l! m! n! v! v! y! z! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! ! " " " " " " " " " " !" "" )" )" *" 0" 0" 3" 4" =" =" @" A" J" J" M" N" W" W" Z" [" d" d" g" h" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" q" r" s" t" p# l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ l$ o$ r$ u$ x$ {$ ~$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ % % % % % % % % % % !% (% *% .% 1% 4% 7% :% =% =% @% C% J% Q% V% ]% b% e% g% k% n% p% q% s% u% w% |% % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % % & & & &
& & & & & & & !& "& #& $& %& '& )& +& -& /& 1& 3& 5& 7& 9& ;& =& ?& A& C& E& G& I& K& M& O& Q& S& U& W& Y& [& ]& _& a& c& e& g& i& k& m& o& q& s& t& u& v& z& & & & & & & & & & & & & & & & & & & & & & & & & & & & & & ' ' '
' ' ' ' ' ' %' &' *' /' 3' 7' ;' ?' C' H' L' Q' U' \' `' e' i' o' s' x' |' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ( ( ( ( ( ( !( &( *( 1( 5( <( @( F( J( Q( U( Y( ]( d( h( n( r( v( z( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ( ) ) ) ) ) ) ) ) !) %) )) -) 2) 6) <) @) E) I) M) Q) W) [) a) e) k) o) x) |) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) ) * * * * * * * $* +* /* 5* 9* @* D* K* O* U* Y* ]* a* i* m* s* w* ~* * * * * * * * * * * * * * * * * * * * * * * * * * + + + + + + + #+ )+ -+ 5+ 9+ ?+ C+ I+ M+ T+ X+ ]+ a+ e+ i+ n+ r+ w+ {+ + + + + + + + + + + + + + + + + + + + + + + + + + + + + + , , ,
, , , , , $, (, ., 2, 7, ;, <, B, F, J, P, T, X, \, b, f, j, k, o, u, v, z, , , , , , , , , , , , , , , , , , , , , , , , , , , , , , , - -
- - - - - !- "- #- " 3 B S d u
+ < M ^ o # 4 E V g x
. > K [ k { . > O ` p 0 > O ` p ~ ! " # $ % & ' ( ) * + , - . / 0 1 2 3 4 5 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 6 7 8 9 : ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; ; H U b p } . > N ^ n ~
* 9 I Y i y Z < z f W 4 nI "L WO P U \ d `e { %| R} ~ \ Ʌ @ U L " , < (
< W \ p : d
C -
& N( x* H+ + , - . / [0 @8 : Z; ` yb c 2d Dd pd e e v w px zz { <| ~ ; ȓ ̓ ϓ ѓ ӓ ؓ ݓ ϔ ϔ ϔ ϔ - - - - - 5 = = = U m ͖ - E ] u 1 ў ٟ i 1 9 ɢ ) a ɣ q ! ) a y Ѩ a 1 y ) ! y a 9 ٹ Q I i ! q ɼ ) I Q A a Y ) k # ' \ . / d 5 8 + K i y ; q v - ` " b i
" $ e( 1 5 ?8 8 }9 9 c: : ; ; < = = ? 2@
A A
B B C 5D D
E F gG H I M P uS U :V W X Y Z \ u o ɖ 1 / % ; ~ Ş b ʟ { { ˣ ۧ w ש [ z u f = U G G A % I V Y 9 5 @ QM N P U W ~Y Y \ b Qc d e Ue f f ug h 1l mr s nu Vv x B Ä i t a ɛ # z ڞ ; Υ F ? s e ͨ } ש W @ h « B + S - ( ` 8 ! I # ~ l R . & r l * ~ 2 , " b ( e ; n 6 ) i ) p E i v > : m ) 0 6 7 8 9 : ; -< m< 9= s= = a> > K? ? @ 7@ O@ @ A A A TB B C C oD D .E OE yE G P S^ b g g Jh h h i i j `k k l *m o o p Rq Ys s u _u u u u Pv x zx x Dy z H{ { | | | | i} m މ ^ > { \ 1 ߓ z 6 Ι x e m U 9 H _ Y 1 E O Ϫ 0 J ʬ 1 k ® * ů ? B b Y [ \ ` | η 6 Ѹ Q չ ߺ B ƻ , ~ i $ % Z + _ { G b * n 2 @ \ ' c ~ ( C ' . N Y u ? ` d E H g 1 O % | d g L d g L d g # & ( * , - 0 1 2 3 9 ; = = E I N P Q R S T U W ] d l q w z { } ! ' , 2 6 ; @ F L R W [ a g l p s y
" ( . 3 9 = C I O U Z ^ d i m q v z
" ' * 1 4 7 : ? G L O S Y ^ c h m s x |
# % ' * - 1 5 9 > D H L Q V \ b f j m s x ~
! # % ' ) + - / 1 3 5 7 9 ; = ? A C E G I K M O Q S U W Y [ ] _ a c e g i k m o q s u w y { }
! # % ' ) + - / 1 3 5 8 ; > A D G J M P S V Y \ _ b e h k n q t w z }
! $ ' * - 0 3 6 9 < ? B E H K N Q T W Z [ \ ] ] _ d e g h l n p q r s u x | ~ " % ( + . 1 6 = @ C F I L S V Y \ _ d i p s v } H y 4 G a n . f s O w 0 > W ` n y < v ' D Z | . = V c | o z , M b , 8 T f m y 0 X ^ x } % @ h ? _ y ( A a + _ ' 0 j q + ` h D J a k # , 9 J R o y + 3 A L { T l ( 8 H m @ [ * C ` { @ j ! '! 3! o! ! ! 8" " " " " " # # $# .# O# V# h# n# u# # # # # # # $ $ $$ :$ L$ X$ e$ $ $ $ $ *% 9% d% z% % % % & & *& 7& C& O& o& & & & & ' 9' a' ' ' ' ' ' ' ' ' ' ' ' ' ' ' ( -( =( L( o( ( ( ( ( ( ( ( ( ) ) ) =) E) M) S) [) a) v) ) ) ) ) ) * >* D* V* * * * * * * * * * *
+ + ++ =+ O+ Z+ l+ + + + + + + + , , ,, k, , , , , - +- K- k- - . . . . / "/ )/ 3/ ;/ @/ D/ M/ V/ _/ e/ n/ |/ / / / / / / / / / 0 0 0 >0 L0 `0 i0 s0 |0 0 0 0 0 0 0 0 0 0 1 ~1 1 1 %2 @2 T2 h2 s2 2 2 2 2 2 2
3 3 R3 c3 w3 3 3 3 3 3 3
4 4 4 +4 64 @4 J4 S4 ^4 m4 w4 4 4 4 4 4 4 4 4 4 4 5 L5 m5 5 7 7 7 7 7 7 7 8 8 K8 f8 8 8 8 8 A9 L9 X9 h9 u9 9 9 9 9 9 9 9 9 9 :
: : *: 3: E: : : : : : ; ; *; 3; >; O; `; i; {; ; ; ; ; ; ; |< < < < < < < < < < = = #= ,= 6= E= Q= ]= l= x= = = = = = = = = = = = = > > > > '> ,> 8> D> N> S> _> > > > > > > ? ? :? H? e? ? ? ? ? ? ? @ @ -@ 9@ E@ Z@ f@ r@ w@ |@ @ @ @ @ @ @ @ @ @ A 4A LA _A uA A A A B 3B ;B KB yB B B B B B B B B B C :C ZC jC tC C C C C D D RD eD D E E 8E KE ]E E F F F &F )F 1F 4F ?F FF dF {F F G (G JG RG VG bG fG rG }G G G G G G G G G G G G G uH I K K K ;L L 3M N *O lO O O O O O P P 7P ;P [P _P sP P P P P P P P Q
Q _Q lQ Q Q Q Q %R 7R CR qR R *S )T T T T T U aU |U U U V W >Z A[ M[ [ [ [ [ [ [ [ \ \ Q\ U\ a\ l\ \ \ \ \ \ \ \ \ \ \ ] ] $] (] 0] 4] ?] F] k] ] ^ P_ \_ i_ q_ x_ _ _ _ _ _ _ _ _ _ _ _ _ <` d` t` ` ` ` ` ` ` ` ` ` ` ` ` a a a a a a a Qb Ub ab pb b #c d d d e e g k gm m n n o o p &p ]p p p Xq \q mq q q q q q q q r r r r r r 8s Us dt t t t u u 7u ;u Lu Xu [u ^u fu iu u u v v v 'w 1w 5w >w Bw Rw _w uw w x <x Hx `x jx rx zx x x x x x x x x x x x x x x x x x x y
y y y y +y 4y ;y ?y Gy Ny Yy by ky oy }y y y y y y y y y y y y =z ez qz z z z z { %{ 7{ C{ G{ a{ e{ x{ { { { [}
~ q~ ~ ~ ~ ~ ~ " / ] n # + / [ _ r z ʀ Ҁ ր ' / 3 \ h ˂ 3 J N s w ă ΄ - ֈ C 3 ˊ ֊ ڊ # I M \ d g j n q t { ҋ P Վ x
3 7 _ c o { $ 9 = đ " & 2 A o s Ò ǒ ϒ Ӓ ޒ Γ u ~ Ŕ Д ה
N R ^ m ĕ Е ݕ 0 C F I L O R U X [ ^ a d g j m p s v y | ė Ǘ ʗ ͗ ؗ ߗ ( 1 B I T ] i t Ę Ș ̘ ט ޘ % 3 < H T _ f o v v | ʙ љ ! % ) - 9 @ I L O R ] d m p s v ̚ Ӛ ܚ ߚ & * . 2 = D M Q U Y d k t x | ƛ ʛ Λ қ ޛ ( 4 ; > A D O V ^ b f j v ɜ ͜ ќ ՜ # / 6 > B F J V ] e i m q } ם ) N j $ П ] ˣ ^ p G r թ E P b p N C \ _ ~ ̷ & Z F u O s ߺ R t H B o ؽ W { о : ? p d 6 o 6 ^ 5 ` 6 g
1 T x C h < a " G l ) a ! Y Q A y 1 y a i 1 ! Y 1 i ! ) a ! Y Q ) a 1 i 1 i I Y Y i a ) q ) y A I 1 i I I A y ! q ) y ) i i ! i ! a Y E } E } 5 m = u 5 m E } m % m e % } =
E M = = M % ] = u U e % } U = u
] e e e m - u
=
% ] 5 m E
}
= u = u M e -
E =
E
M M M U e e
U
U ] % m u 5 }
E e
! U! ! =" u" " # =# u# # # =$ u$ $ $ =% E% M% n $ o - ? Z w k D t n n n & F n $ o - @ [ w l D u n n n & 9 n a s n a g ) W r w D n n n ) 8 O + n G V n r . H = H C n R H [ H e
5 . H = H C n R H [ H e
! J w q q q W U
h 7 z
; A W S r Z r a r W ! a w W + Y W < a y q q ~ r p } p ~ y A * M > f T ~ P n P n 2 R e b 7 ! 5 C V i i h 0 + W o T ( ` < n S f ` n 2 Y 5 o Y z & n 8 a n y G , 5 M T 6 X T k e e > [ z y n n F a T t e e t t b t b t b t b b b b t I n c W s s
o { s s
u u
X u u
.
) / z
' q
/ 8 N n p w
D F
x
e ~ D d D !
S
A Z h D A / A 6 Y Z a / ^
& u / C U t c j u s t u t u % t 3 9 t b ` t b ` t b ` t b ` t b b t t t
A M t T t o
u u
; u u
" 8
O
w w K T 2 O l z n n o ( z I n [ n o ( D A
2 (
E
z f
n x
n
o N g u D
3 2 q z n n
2
o
D +
z n 9 n q o
D
5 R z s n n o E O H f u o t u t u ! t / 6 u A U g t u { b b b b z = Z q
6
M
` R o z n n d
! > W > c t
A & ^ , ` 5 a
Y E z n + n A z I h z n n ! O t Z a + S l Z / ~ ~ P i E ~ > > > > > C > O f >
, ] T e & H e A t t t p b b b b b G F %
- q
' a r w ? H H n H H a G
`
q z n $ t t A u 0 t A G t b ` t b ` t t t p b b b t /
A j z : {
J
# 6 i v v v , W U t
) y u u
A
M
u T
u o
J
i I
G
5
1 = x
I / j
D !
V }
D
T {
+ P
; b u t u t ! & ^ + ^ 2 = H G L ^ R A d $ ~ f A q ^ w % B z q n ! @ b 4
K h + t t t t n u t p $ q - J n a x 9 D g . H = H C n R H [ H e H % n e b @ b @ b H g
, 3 ` n n
n z n z I n Z g n ! >
5 > A U ` a ; Q s z { % H
t b t b ` t b ` t b ` t b ` b b b b
A y y
i u y | y
z z
E z z
: P
g
z F $ w # w 8 K f 5 & @ H % H + n 5 H > H C $ 2 D f 5
D M
5
D H
D
0 u 9 M _ t m t u t u t
t t t b t b t b t b t b @ b b b b t b ` t b ` b b V ; n o ) v : P
f ( 4 x ; x V
x x /
s z z
/ ; z B z ]
( Y r
+ n A M } c } K ) 1 ~ z . > G
~
/
@ ) H 3 H 9 n E H N H S " A ` s . + +
>
c
q
@
H
H
n
H
H
0
a
I % X D ) # D # * C Q D " D A " 1 ; A z { ! z { E z n o ' % A ( f n K W z ^ z y
D P
! - z 4 z O
D
& 2 ! L! ? X! H b! i! H o! n y! H ! H ! ! " S" 2 {" " "
"
# ? # H # ## H )# n 3# H <# H A# J# # $ u $ $ $ t $ $ $ A $ A& / ' / h' o q' |' n ' k( / :) / !* ^ * / 7+ $ ), / , ~ - ~ {- $ !. ^ ,. ^ 3. u A. U. g. t u. |. u . . . t . . u . . . t / / t b @ b p b p b p b
A 2 c ! 0 ! + n G N r U r _ n q } 2 2 J c
B 2 c
6 t 2 ! c W m
= y
+ ! 5 n L S 2 ~ ~ k ~ ~ / % r ; n 1 L o ' ( A ^ ^ + ; a m } ( b b b b b b K | f
} } K F
e H | : D H
, , + A T
0 * z n - ) > n K S : ^ g ; z ) { - 5 A p n T " i C n U # = K a T > % > 1 H # y n E + q n n n . S = n n ` # s D > > % % V n + + ~ P > ' > 3 a > m & F
> R
$
^ 0 C T >
>
*
" [
^ b b b b b \
8
k , * $ b b ~ ~ R ; w z A ~ v ; z X ~ ; z : z n # n Q : ^ y o M
t ,
, " T \ o T n n n 5 O n a s n H
q
:
z 1 n G i n : o A ^ ^ ~ ^ ^ ^ K P > > > # > / C ' q # b b b t b {
$
;
"
8 x u % 9 L t Z a 8 G ] ( | $ - j w q ! 5 a { 5 a { 5 a { n { 5 a { v { ?
G { ? { 1 G @ { ! ? - g w / Q q @ / C 0 P @ I T n v
> G n ? B H Y t w P n + : 8 B U o a p n ) G P W a l n n P
4 W
4 n 7 H B F m n h ' A Y E % @ ~
4
4 K ) 8 Y H n R h m Y n ) n A 7 g n 7 7 G n a 7 k y n 8 n
@ &
^
Y n ! 8 K T n 8 n 7 n n % d ` n (
A
Y q
n
7
n
7
n ! z / n S 8 ` n u ` n / n Y * n 7 \ n i x C 2
> U G y n B
w 7 P n : B o n ! 7 n O X a z n n 5 n S c n w ^ n v n = n [ k n 7 n O X a z n n n 7 n O X a z n n n n # ) = n T k R n i y n ( ~ k ~ B + - . / n ( n E n n " + Z + y , . n * n G n * , n n A n n 3 K ` b n e K J J ~ X ~ ; @ l 3 ~ : ~ a H ` C { K N R O m v : n S J J 2 n H R 0 n P J a N 1 % , n " < I n g @ N N j s 7 n P 8 ? D [
q
@
C N h ? + 4 H 8 e r n
A
7
N ? & A N Y * B N A I ! ; * K o N ) 9 n P ? [ N C 2 d & ] > 3 9 n S ' ] ( 3 h
F F
+
> A G e n z B w + P n : B o
n 1 > 5 n 8 > 4 n @ } 6 + > A J ( N R J N J I 2 # z [ n o = 2 ? n W 1! :! N! < k! x! n ! " N W" n " " 8# N# @ # # # ; # # n # $ + N > n - P N T Z ' K `
> e
n $ + K ^
4 e
4 K ) n " K ' 8 N T N V # 2 * H a Y Y 1 # 4 N a r N S a u @ n ! 5 A R _ n w
4 #
4 A K O X l ? n 4
D 2
?
n W
<
E
# $ n A [ h n A O a N
2 .
a
1 S 2 B + C + n 5 O \ n y 5 E
A J ^ + S ^ q 3 i X a B T V F + n 2 I V n s 2 + N N y H # M Z l : k x * < M T Y z `
p `
p `
p @ G N b i p J Q X i p w
U
! ) 1 7 " ) H O V b i p v
T Y c `
p `
p `
p `
p `
p 1 8 ? d
' W <
w
A
D + W + i A 9 e b e b e b e e b e b e b e 5 ] o
~ s n s s
t n t
t > P
_ u e n o u x u @ w n w w ! ( H Z
i x o n y x x
y n y y .
= z C n M z V z [ | @ } n } } G ~ n ' ~ 0 ~ 5 : P J Z , m ` - ` . ` / ` - B 0 U ` f n u ~ O L K
% ` 9 n U ` n j q z 4 f ( 0
/ 8 @ l H j P X > ` h ^ _ ` a b 0 J g G ' G A G c d e f g h i j k l m n 0 @ P ` p
$ ( M 0 % ( M , 8 ` P N ` O h x P $ ( Q 0 & ( Q , 8 ` P N ` R h x S $ ( T 0 8 N H V L P
T
$ ( T , 0 8 N H V L P
T 4 $ ( Y 0 8 N H V L P T $ ( Y , 0 8 N H V L P T 5 $ ( i 0 * ( i , 0 N 8 ` P N $ ( k 0 * ( k , 0 N 8 ` P N ` l d & ( m , 0 N 8 ` P N ` n h x o ; p q $ ( m 0 $ ( x 0 % ( x , 8 ` P N ` R h & ( v , 8 ` P N ` R h x z V 1 | 2 $ ( v 0 8 N H V L P T X | \ ` d $ ( 0 * ( , 0 N 8 ` P N ` d $ ( 0 ' ( , 0 N + ( , 0 N 8 ` P N ` h x p $ ( 0 8 N H L P / T / , ( , 0 N 8 ` P N ` h x $ ( 0 $ ( r 0 8 N H L P T X \ ` d h l p L t L x | G G ( ( l ; ; I I F F K K N N p S S R R ! ? ? # A $ A ( , % 0 E 4 E 8 < ' @ > D > H L ) P @ T @ X \ + ` B d B h l - p C t C x | H H # T T / M M ) J J 1 = = 3 D D 5 P P 7 < < 9 O O ; % % = $ $ $ ( , ? 0 " 4 " 8 < A @ ' D ' H L C P # T # - ( r , 0 N 8 ` P N ` h x
> o ( n 8 @ P X h p ; ; ( 0 ; $ ( 0 8 N H V L G P T $ ( , 0 8 N H V L G P T 7 $ ( 0 8 N H L P T X \ U ` d h l W p t x |
Y $ ( 0 * ( , 0 N 8 ` P N ` d u $ (
0 8 N H % L / P T X & \ / ` d h ' l p Z t Z x | ) + - / . 0 2 4 6 7 9
$
( : , ) 0 4 8 ; < @ D H = L P T X ? \ ` d h A l p t x C | E
G ) H J L . (
, 0 N 8 ` P N ` V h E x W X ; Y Z [ ; \ ] ^ ( 8 _ @ P ` X h a p [ % / & / ) + - / . 0 2 4 . ( , 0 N 8 ` P N ` b h $ ( d 0 * ( d , 0 N 8 ` P N ` e d $ ( f 0 8 N H V L P " T " % ( f , 8 ` P N ` j h x k V " 6 $ ( l 0 8 N H n L P 0 T 0 $ ( l , 8 ` P N ` p h x q ; $ ( r 0 8 N H n L P . T . / ( r , 8 ` P N ` t h b x u v w x $ ( y 0 8 N H n L P % T % $ ( y , 0 N @ n D H % L $ ( } 0 * ( } , 0 N 8 ` P N ` ~ d $ ( 0 8 N H n L P T * ( , 8 ` P N ` h b $ ( 0 8 N H L P T X \ ` d , ( , 0 N 8 ` P N ` b h x * * 0 & & & 0 & * 0 0 H 2 * * 0 , & * * 0 * 0 , H & * 0 * H * ` * x , + 0 6 0 0 1 H 3 6 3 % 0 & % 0 % H & ` & ( % * 0 0 H % ` % x & * * 0 * H * ` * x * * * * % & H A = p E 2 6 A M W [ 9 f l v z P ; * P # P 5 N ; N h O < O Q @ Q H A { / f " \ E $ p 8 < J " N 9 \ " ` s k w # ' P @ P # P N < N O = O ^ $ R ( 3 " R 7 < , R @ E 9 R I O Q S ^ Q b T X E x P
X P ( # . # P 2 = 7 N ; F N J p O O S P ^ O b g * O k ; u R
" R ! , R % 3 * 9 R . m X ; u O ( > ? # C M Q 3 ] i m m r B v B C , k C
D P D G ( D { 1 D E E F
F X ; u O ' / S F # J T X 3 f 5 u m B B C , k C
D P D G ( D { 1 D E E F " 1 F 5 H 8 ;
\ _ ) w z j ; % - D # H R < V 3 b h q 5 u z @ / = T > ? W 0 @ 9 < " ! ( M , 4 C M G o L M P V J Z b q 4 J u r { T T M } M M b J 4 J E I 9 K ' > @ B N F \ G ` = o H s F A G H 1 G S S S S C ' S > # B
N X ; u 2 R g * 2 G S K W " [ 3 g " v " z m " * P G " 6 6 J 6 8 ] 8 # 8 7 & 7 * _
;
:
, : ! 4 : % 3 9
& 9 ; ; ;
% ; ! & - ; * 3 0 : 4 6 < K , : O T 4 : X
x
H
H
H
;
0
#
|
*
]
"
=
(
{
;
0
c
c
e &
. E
C S G $ S c W 3 $ e d i $ e $ f ( $ g $ $ 5 $ # G $ G t $ U
$
E
+ h / " $ 5 p # A " E } $ K # T G X $ ] # j d n U $ z h ~ $ # $ # $ @ # " $ 5 $ $
$ I
-
(
7 - ; $ @ . D
L
] 2 a # l 2 p $ u ( 2 y $ G # G $ A # A s
$ G # G @ # H
# H $ H
# H 3 $ H 9
' i
6 H : $ ? # H C ( $ I H M
U
d # H h $ n H r
z E
H $ # H
$ 2 # ( 2
$ - # . # . [ $ 8 @ # 8 $ # 8 $ J
, J [ $ $ 4 J ( $ h x ( h X ; o = ! " W [ y G t p e g % - B S F ) T e X 3 ) e h r c v g ) ) " 5 ) ) 9 ) m )
) m
) R s
+ / O ) : > ) D L * \ ` ) k o S ) u ( ~ G ) ` ( G ) o F q ) G ( A ( H p ( # H ) G ( G ( H ` ( $ # H ( ? ) . - 2 ( = . A ( N 2 R P ( ] ( 2 a ) g - k s - ) . H V H l ) # H ) H * R # H h ) H # H ) A u ; # : g > - L d P 9 - f e j m - v 5 5 - ; u ; * 2 5 G S K 1 W t [ 3 1 i 5 x m 1 H ; u I . 6 N K S O 6 [ y _ 3 6 m 5 | m 6 6 5 A 6 8 @ 5 8 6 # 8 6 H ; o ; $ , 8 A S E ; S e W 3 ; c i : u m y g ; 9 @ : & 9 ; ; n & ; " * ? S C @ P h ] c ; g ? r % ; v 3 @ { - ; f @ : L , : @ 4 : @ h 8 8 x B < p F z ; j ' / } D S Q g U E a c n " { D ` D : E - D . D . 4 E / 0 D & / h E 0 D ' 0 E @
. 1 2 0 D > A B J Z B ^ p D i B m E r C v ~ C E D D D > E ( D r E 1 D E E E E F F E H v R j g P 5 c 9 J E c K - O I Z - ^ n J c . g @ I t 2 x I 2 J ( 2 J J ( X
8 X X
H ( h 8 X X ; o F ~ l Z & u b R
P #
c g
O
l o # V C e j ' / [ D S H O V f Z 3 O f c s } g O N G O N d O c > O N O O P
N O
N
v O O
N ) - d O 4 0 N @ D O O S R O X N c g O n N y } O P N m O N O P
N O
N Z O
N O @ N O N J O , F 0 O @ F D O I N T X H O ^ N g " k O q N z ~ O N O N
O ` N " [ O N O N O 0 N _ O I # J ' N 2 , J 6 O ; 4 J ? O E H I Q ` # H d G
O j - n v . . O 6 N 6 O 6 M N M d O M O - N . N 2 N ( 2 g O % G ) F 1 T A A E N Q G U N a H e N p # H t O z - ~
.
. O 0 P N ' 0 N O / N & / O L P N L O H
5 ! # H % O + 1 / N ; K ? G M V K Z ; O _ ! K c O h > K l O r H v ~ # H O ; J
j , J S ( . 4 J 2 3 S ; o % - - B S F X Y G ] 3 X b W k G o g X X ; u * " * ? C ] S W 3 ] c q G u m ] z \ G ] P \ " ] ; u " * * ? C b S W 3 b c i / q ~ G m b a b , 4 I M f Y " X ( < p j # 8 c E F K - O j Z . ^ P j i . m k t / x j & / 4 k 0 j ' 0 h k 1 j 2 j ( 2 k E 8 < o F J = o V \ j ` ( h u w j { w o k " k o * k o ; k
m " k s ! * k % 3 s 1 X ; u Q % X ' / w D H x R V 3 x d e h m x t c x B w B x C , k C I x D P w D x ( D x 1 D x E E x F ! 0 F 4 P x < - @ H W - [ x ` . d l } f # + @ D | P " ! ! A ! ! ! ! # < ! : > J " T g X 9 h y 3 3 4 @ ! L ! " x " " " ; " u " " " B " " " " I " | " " , " 4 " I M Y ] 3 k e o m { d # d + d : 8 d e p " e ` ` e 0 " " " e A ` D " " , ` 0 t # # # ; # u # # # # : # # 0 # 8 # M Q ] a 3 m { G m < = 2 $ H $ $ $ X $ $ $ X $ $ $ ( $ $ ; $ $ $ | $ $ $ l $ $ J $ $ / $ $ $ $ G $ z $ $ # $ $ $ $ ' $ /
$ D H T c X 3 e m t z z $ $ G $ $ - . @ . t 2 ( 2 G G A P $ A ( d . H 2 = # H A G G K W H [ P f # H j B p G t B B C $ G $ C ' D D ( D 1 D E e $ n $ E ? F v $ y $ ' F + r 3 H 7 $ ? $ N H R W # H [ a H e t $ m $ | H # H % H % % % % 8 % x % % % % 8 % % % H % % % x %
%
%
% H % % % H % % % 8
%
% X % % % H % % % ( % % % h % % % X % % % 8 % % % ; % % % % k % % n % 4 %
% %
% % % % P % % O % % A % % % r % % % % Y % % % B % % % A % % % % ! % " % $# % j# % # % 6$ % $ % n% % % % :& % & % ' % ' % ( % V( % ( % <) % ) % * % * % G+ % + % ", % , % - % Q- % - % - % - % . % . % / % L/ % / % / % / % 0 % 0 % 1 % 1 % "2 % 2 % 2 % H3 % )4 % 4 % #6 % V6 % 6 % 6 % 7 % V8 % 9 % : % V; % ; % < % |< % < % = % > % 9> % n> % > % > % ? % :? % q? % ? % ? % @ % C@ % v@ % @ % pA % B % B % B % C % % # % + / % @ D P c T 3 b e f r G f c c c f c , c c
1 5 @ D I T < X H c g l @ v e z G c G 9 g % % g j 0 " p F m / F 3 > G B Q G P G T Y 0 f d j o z ~ : d @ G 9 d p G <
!
$ e ( " 8 F < # A
L P b# V
a e # l @ u = y .$ > $ f% @ % 2& c & 0
c y' - ; % K % . < % K % 0 2 4 Q % < ] % K ( 2 R - V % ^ % m . q % y % . ' 2 % % ( 2 ( - % % - N( . % % 2 %
% 2 ( ( 2 ! 4) ' G +
6 G : z) @ A D P O A S * Y G ] i - m x - | * . @ H # H ?+ G f % % f + H
%
% # H B % % B ! , & C * ' % 2 W % A C E , K D O g % W % f D j - o ( D s I- x 1 D | |- E t % } % E - F % % F - B u
%
% B . C
%
% C . D
% "
% 1 D 5 / : ( D > D/ C 1 D G w/ L E P
% X
% g E k / q F u
% }
% F / H W % % H 0 # H 0 H % . % # H 1 H % % H
1 # H 2 I ( I , 2 2 I 6 A I E 2 K I O Z I ^ @3 d I h ` s I w !4 } I I 4 i ' i 6 / i N6 Y % % Y 6 Q P Q 6 I
% % I 6 G % ' & % 6 G : N8 @ - D O - S 9 X . \ i H m % u % H 9 # H N; I % % I ; A % % A < H 0 # H t< G
-
%
% %
- )
< .
. 2
% :
% K
B O
U! % W
! % f
B j
= o
C s
V! % {
! %
C
=
D
! %
! %
D
1>
( D
f>
1 D
>
E
! %
! %
E
>
F
! %
! %
F > B # % " # % 1 B 5 2? : C > # % F N# % U C Y i? _ D c ^# % k # % z D ~ ? ( D ? 1 D @ E k# % t# % E ;@ F |# % # % F n@ I
& %
& % I @ I
& % & % ! I % hA + i / 2' % 7 K' % F ' i J B O / i S B X Y \ 2' % d :' % u I y 8( % ;( % I B I ( % ( % I C & h & & & 8 & & d & & & & # & V & & " & U & & & F & & & & e ; g & & 7 c ; G K \ W [ ` & h c & x | m & & N & # & F M -
` . ) 2 - 8 ( 2 < B - F & N & ] - a f . j & r & g 0 g > h & w & h f & P & f ' X ' X ' X ' ' ' ; ' o ' = ' r ' ' 0 ' ' # ' V ' ' _ ' ' ' j ' ' / ' D H V f Z 3 e c v z g e 5 F j F G ( P d P G e ' ' < N # P - e 1 < @ W E P T ( ( ; ( n ( ( ( ( & ( ; ? K Q ! ( Y ( h < l 3 w { f ) ) 8 ) ) ) ) X ) ) ) ) E ) ) ) ) ) ? ) r ) ) " ) ) ) ` ) ) ) a ) ) ) ) ) " ) 8 g < G f S ` f d = m q v G } 0 G d 7 j g f P X # - 1 : D H Q ? U ) ] ) k " ? o Y u = y ) E ) = # = - = * H * * * ( * h * * A * u * * ~ * | * * * * * * * C * * * * * ? * * a * * * ; * & * < g @ I M 9 X d d q d u m " v t G G G { @ F
" # ' . = d A G ` V d Z f g j ; p = t * | * = - = > u * * > { > = ? * e * = # = - = 7 > " * W * > > & = * $ * 2 G * A = E Y J - = N + + + + 8 + + + + + $ - + ; g ? O d S X a G e n G r 0 w + + d x , ; , , ; < ,
, < ! < % 3 1 G - h - - H - - - H - - - - A - u - - - N - - - - D - y - - 1 - d - - 7 - - - ; - #
- : g > L f P 9 ] d a m m G ` G F G G @ G G <
q 0 G 8 @ A G E J S G W ) ^ < b n = r - z & - = \ # = - = = P - s - = / - = . . $ . , . A E Q " / / X / / ; / / / / / / / v / / e j g ! / ) j / B d F P c T 3 r F v c G G g 2 P 2 2 ( 2 n . O / ` / 0 ; 0 0 # 0 + 0 ? C N " T 7 X * 0 ` < 0 n 7 r 3 1 1 ; q 1
* 1 " q % 5 + * q / 2 2 ' ) 2 ; 5 H 3 A 3 3 l 3
3 l ' - ! l 1 9 4 A 4 z 4 4 m 4
4 m ' = - l 1 4 9 e 4 G l K 9 P ! l T r 5 A 5 z 5 5 n 5
5 n ' > - l 1 5 9 e 5 G l K 9 P ! l T r 6 r 6 6 ; p 6
6 p % ? + l / [ 6 7 6 E l I N ! l R j 7 A 7 z 7 7 o 7
7 o ' @ - l 1 7 9 e 7 G l K 9 P ! l T r 8 H 8 8 8 8 8 U 8 8 / 8 8 8 8 s 8 8 x 8 8 R 8 8 8 8 $ 8 8 8 8 8 8 ; 8 8 8 4 < 8 C < I Q = U M [ @ c > g m v @ z ' ? 5 n 8 8 n l 8 8 l k ! l o m 8 8 o p l n 8 ' 8 5 l 9 > ! l B J I p M 8 U 8 d p h m l q 8 y 8 l ! l m 8 8 m l 8 8 l ! l q 8 w 8 " q * q 9 H 9 9 E 9 9 9 9 x 9 9 9 % 9 m 9 9 9 9 C B 9 ! 9 6 1 : F P T = ^ 2 d ^ h 9 p 9 * ^ 2 ^ : ^
[ [ p \ @ \ + \ < \ ] } 9 Y 9 ] e ! ] + ] : E : : : & : ; 6 ? K U Y = ; h ; ; h ; ; 8 ; ; ; X ; ; h ; X ; ; ; h ; ; ; ; ; ; ; ; j ; ; ; ; ; ; ; ; 9 ; ; ; K ; ; ; ; 3 ; y ; ; ; E ; ; y
;
; ; : ; ; ; M ; ; ;
; ; ; ' 8 ; < @ L < Y c < g 3 r v { < ` 5 m b ` F " F " 0 G b # . % b 2 7 I b ; 1 A U E ; M $ ; \ ' U ` f b j P u % b y ~ I b C c ' c : c _ ` _ ( _ 3 _ + b P % b q 5 b I b a " a
* a = 6 a $ @ a ( q
- I a 1
6 _ : E _ I
N 3 _ R 2 Y a ] ` h " a l x q * a w 6 a { @ a E I a _ _ 3 _
< ; < o < < < b <
< % b ! - b % 3 * 5 b . g 3 < ; m < D I b H M R b = X = = = ; = y = = = [ = = = = Q = = B ^ =
* = * ^ ! 2 ^ % 3 * / : ^ 3 q 8 D ^ ? [ C P N [ R W \ [ e \ i n + \ r S w < \ { ] = = ] ! ] + ] I > ; > o > > _ >
> _ ! ( _ % 3 1 G 7 3 _ ; g ? ; ? ? ` ?
? ` ( G . ' ` 2 3 @ ; @ @ @ d @
@ # d ! + d % 3 * 8 d . A A ; A A e A
A " e ( F . ` 2 = ` A 3 B B ; B n B B B c B
B ' c ! / c ' : c + 3 0 _ 4 ? _ C f H 3 _ L C C ; C u C C C C I C C a C
, C " a ! * a % 3 * 6 a . m 3 @ a 7 < I a @ E _ I T _ X ] 3 _ a A D ; D D U D
D ' U ! / U % 3 1 E x E E E H E E ; E o E E E z E E E M E E E Z E E ; $ E , E A E $ O a S 3 $ _ F i G m g $ r ` v # ` $ ' ` $ U p # ' U r $ / U $ U # ' U $ / U E $ U # ' U $ / U $ ` @ # `
R $ F F ; F u F F F ; # F + u F @ D ) N < R 3 ) ^ < k F x " | m ) ( " ) G G " G * G ? C - O < \ H H H H H 8 H x H H h H H H H ( H H H X H H H h H H
H X
H H ; H H d H H H , H H H H y H # H H H H H H *
H
H ( H r H H H a H H H H /
H w
H
H
H H } H H " H U H H H H G H z H H W H H g H H D H H H H H H H J H } H H H H C B " H * $ H ? C 2 O < \ f H j 3 2 w F m z 2 2 1 \ 2 @ 1 H 2 " 2 $ 2 1 " 2 " 2 " $ 2 ) 1 5 1 9 q 2 D H 2 P 0 1 _ H c 2 p G t 2 y p 1 H 2 H 2 2 1 "
2 ` 1 G
2 1 H 2 H j 2 1 G 2 1 G 2 1 & m * Y 2 0 W 4 H < H K " W O 2 T * W X 2 ^ U b j H j H y ' U } 2 X N H m H X '
2 U H H ' U o
2 U } H H ' U
2 U 1 ' U
2
/ U 2 X H H / X 3 u 2 9 X = 3 H E R H T X X 2 ^ U b g H j H y ' U } 2 W H H " W M 2 * W 2 Q 1 U ( H b H ' U 2 Q P 1 Y H H Z 1 ! $ Z % 2 * X . H 6 H E Y I H Q H a U e H m H | ' U ? 2 Q 1 ^ ` 1 * ^ r 2 2 ^ 2 : ^ O 2 [ 1 [ 2 \
1 \ _ 2 + \ 2 3 \ < \ < 2 ] P
1 ] 2 ! ] " 2 ' + ] + 2 4 W 8 Q H @ | H O " W S 2 X * W \ 2 b W f @ H n Y H } " W 2 * W B 2 U H / H ' U u 2 U .! H h! H ' U 2 U # H # H ' U 2 I I ; I I I I . I a I I I ! I ) e I > B 7 N X H \ 3 7 a W e [ I m t I | " W y 7 * W 7 X t I I X 7 U I I ' U & 7 W I I " W Y 7 * W 7 Q 6 J J ; J n J J J J ' J < @ < E ; N H R 3 < X W \ I J d n J s " W w f < | * W < K ; K o K K K & - K ; ? @ I H M 3 @ X F \ g @ L L % L - L B F D R M ; M M M ; i M
, M ' i H ( G . / i 2 3 H 7 Y ; M C M R Y V y H N ; N o N N N " N * + N ? C L M H Q 3 L \ F ` g L e U i N q N ' U L O ; O O W O
+ O " W P ! * W % 3 P P h P P P P x P P 8 P P 8 P x P P P H P P P ; P o P P P t P P e P P l P P " P [ P P # P k P P P P P 7 P j P P P
P J
P }
P
P
P P I P | P P P M P P P P Q
P P ; P & P ; ? U M G Q 3 U _ F c g U o z H ~ U H U G l U U ] U T H U ` T G d U F F U " $ U / " 3 S U > G D T P G T U a G e U p G v T c U " U T U G p T " U T U G / U X B P Q P X $ b U * Y . P 6 P F W J U P R P a " W e U j * W n U t W x P P " W
U * W B
U Q 0 T Y P P Q T U P P P ' U u
U W P P " W "
U ( U , P 4 O P C ' U G
U M U Q L P Y P h ' U l U r U v 0 T ' U A U 5 P P # 5 t U + 5 U p T ' U U / U U W z P P " W E U * W x U Q
T Q T & U * @ T 5 ' U 9 U > / U B U H Z L T W $ Z [ I
U ` X d P l P { Y P P Q ; Q Q 5 Q
K Q # 5 Y ! + 5 % 3 Y R R ; R o R R > R R R ( j R = A ^ N h R 3 ^ ] F a g ^ j " n ^ s ] | G 6 ^ S X S S ; S S S T S S S ; S &
S ; ? c I " M 3 c X F \ { c e i c x G X . S = S Q b U P b ' U L c / U c T ; T T T T C T v T T T T n " T * T ? C g N F R 3 g [ H _ g d V h L T p s T V g W v T T " W g * W ; g V T 3 T V n g W 6 T [ T " W g * W g U U V U
= U V k ( F V V h V V V V 2 6 o B F L P o Y G ] ` o W W @ W W W # W 8 " < s H F R V s _ G c 8 s X A X X 8 X
X 8 w ! # 8 % 9 w 1 Y Y 8 Y Y Y A Y Y Y G Y C Y Y Y l Y Y Y Y Y Y ! E Y 6 : | D H 9 | ^ F b w | n { G | ? | ; | { G | { | G d | 0 { | { | 5 Y & Y # 5 " { | Z X Z Z ; Z u Z Z Z Z Z Z Z & Z . Z C S G Q " U 3 a G e m p t y G P ~ G 5 Z Z # 5 [ [ A [ [ [ [ [ i [ 2 6 @ D 9 I 8 M X 8 \ w a # 8 e \ H \ \ \ \ A \ \ & \ \ \ ` \ \ \ \ \ 5 9 C G 9 S _ c h s w } @ G X G \ \ ] Z ] ] ] ] ] ] 8 " < F " J R V " b G f o " s ^ ^ = ^ r ^ ^ ^ ^ F ^ { ^ ^ ; ^ ^ + 3 / M ^ 7 g ^ F 3 J O 4 S U ^ [ a ^ l 3 p ^ x ^ 3 5 4 ^ ^ 3 . ^ H ^ 3 j 4 6 ^ B ^ 3 ^ ^ 3
4 ^ ^ / 3 3 > 3 B G 4 K @ ^ S L ^ d 3 h ^ p ^ 3 4 ^ ^ 3 ^ & ^ 3 > 4 ^ ^ 3 ^ ^ 3 s 4
^ ^ & f * ^ 2
^ ; # + B G ; " * A G ' > <
F " * % ? 1 J N Z ^ 4
p ' < ; & = G < ' % < H G L X \ 4 # + @ H M < # + % @ N G R ^ b 4 ; % - % B " O G \
p
6 " ; o $ 8 < E I 3 R F V g ; o $ 8 < E I 3 R F V g
r
;
'
= = F = J R V j _ c r ; & < > E > I Q U j ^ b ( ? < L ; o % 9 G = F G J 3 S F W g ; # + A 5 N m R Z 5 ^ " * @ I 5 M ; o " * > a B K a O 3 X F \ g ' / D H V 5 e r ; ( > @ G @ K S W j ` d # + ? # C P 5 ^ ; ( c ? G ; ' c > G $ p ; D y ' < 1 @ J N < Z ^ q $ p 9 = ; # c : G I ~ $ 9 = H G L A X \ v ( = H A M = r ( = A N G R 5 ^ b j ; " * ? " C O G \ ! + ! 3 ! J h V m b " u " " " ; " ' H " = ? F J S W m _ ? c # ; # o # # # # + y # ? C L P 3 Y F ] g $ ; $ o $ $ $ $ , v $ @ D M Q 3 Z F ^ g % % & % . Y % E " N R & / & 7 & O m ^ ' ; ' o ' ' ; ' " ' 6 ( : % C ( G 3 % P F T g % ( ; ( o ( ( ; ( " ( 6 , : ) C , G 3 ) P F T g ) ) ; ) o ) ) ; ) " ) 6 0 : - C 0 G 3 - P F T g - * ; * o * * ; * " * 6 4 : 1 C 4 G 3 1 P F T g 1 + ; + o + + ; + + 0 8 4 5 = 8 A 3 5 J F N g 5 / / 1 2 3 0 4 @ 5 P 6 ` 7 p 8 9 : ; < = > ? @ A B C 0 D @ E P F ` G p H I J K L M N O P Q R S 0 T @ U P V ` W p X Y Z [ \ ] ^ _ ` a b c 0 d @ e P f ` g p h i j k l m n o p q r s 0 t @ u P v ` w p x y z { | } ~ 0 @ P ` p 0 @ P ` p 0 @ P ` p 0 @ P ` p 0 @ P ` p
0
@
P
`
p
0 @ P ` p 0 @ P ` p
0
@
P
`
p
0
.
,
-
0 @ P ` p 0 @ ! P " ` # p $ % & ' ( ) * + 0 , @ - P . ` / p 0 1 2 3 4 5 6 7 8 9 : ; 0 < @ = P > ` ? p @ A B C D E F G H I J K 0 L @ M P N ` O p P Q R S T U V W X Y Z [ 0 \ @ ] P ^ ` _ p ` a b c d e f g h i j k 0 l @ m P n ` o p p q r s t u v w x y z { 0 | @ } P ~ ` p 0 @ P ` p 0 @ P ` p 0 @ P ` p 0 @ P ` p
0
@
P
`
p
0 @ P ` p 0 @ P ` p
0
@
P
`
p
0 @ P
` p 0 @ P ` p ! " #
p n
p
F p Z .
> C
0
p E b e 1 _ ( 0 0 = 8 a @ ` H ? P @ X 2 ` A h B p C x ^ D > E 3 F 8 9 < G H 7 I J : / . 5 - %
F C ; ! ! ! ! ! ` 8
Y U ~ ~ N ~ ~ ~ a { a { ` 8
m k ~ ~ w q a g N ~ ~ `
a { `
0 L 0 L 0 Y J ! J Y 0 L W A j ; q J `
{ ! ' U ~ s N K ~ ~ ! ~ Q ~ m C ` Y
z L z L z L z L ~ M j c M g 9 M j c " + : M j c # , : M j c $ M j c $ / : b # ; e b < ' 5 F " % " ; G ' * S 0 S = " ) S 7 " G G V = ) " 2 " " " & F j c j e j g $ > - < 6 9 e M < e < j " c j c ' j c 0 S ; ; % / H : G H G $ F % E
p E ;
p & G / 9 F ( # n ( # 5 " B " E ; + 5 " H & . H n n ; n ; ( G C
F 1 C ;
F 1 ' G / 2 8 F @ 2 C
F 2 ' / 1 . 6 1 @ ? J F $ / G 8 G # , G & 2 " < " E F N G ) 1 E F N " X F + 6 h ? G ' 4 G = G & " " " & " + 4 G p & . & " = ! > # @ " ? & 5 2 m p # q # r $ s & g " t * g " u * g v w ! g x ( g $ y , g $ z , g | ! @ } ! g ~ $ A B B # C # C & & # ! $ D E D F G $ ( U 0 $ ( U , 8 @ $ ( W 0 $ ( W , 8 $ ( X 0 $ ( X , 8 @ $ ( Z 0 $ ( Z , 8 @ $ ( [ 0 $ ( [ , 8 $ ( \ 0 $ ( \ , 8 @ $ ( ] 0 $ ( ] , 0 $ ( ^ 0 $ ( ^ , 0 $ ( _ 0 ' ( _ , 0 8 $ ( ` 0 ( ( ` , 0 8 $ ( a 0 ) ( a , 0 b 8 P P c X h d p e f $ ( g 0 $ ( g , 0 8 @ H $ ( h 0 $ ( h , 8 @
F H
F P $ ( j 0 $ ( j , 8 @ $ ( s 0 * ( s , 8 P $ ( t 0 $ ( t , 8 @ H $ ( u 0 $ ( u , 0 $ ( w 0 $ ( w , 8 @ $ ( y 0 $ ( y , 8 @ $ ( { 0 $ ( { , 8 $ ( } 0 $ ( } , 8 $ ( ~ 0 $ ( ~ , 8 @ $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ H P $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ H P $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ ; H $ ( 0 $ ( , 8 $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ H P $ ( 0 $ ( , 8 @ ; $ ( 0 $ ( , 8 @
F $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ ; H P $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ j H P $ ( 0 $ ( , 8 @ j H P $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ H P $ ( 0 $ ( , 0 ; $ ( 0 $ ( , 8 @ j H P j $ ( 0 $ ( , 8 j @ H j $ ( 0 $ ( , 0 $ ( 0 $ ( ,
8 @ H j P X ` h $ ( 0
$ ( , 8 @ H $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 $ ( 0 $ ( , 8 $ ( 0 $ ( , 8 $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ $ ( 0 ! $ ( , 8 $ ( 0 # $ ( , " 8 $ ( 0 % $ ( , $ 8 @ $ ( 0 ' $ ( , & 8 ; @ $ ( 0 ) $ ( , ( $ ( 0 + $ ( , * 8 $ ( 0 - $ ( , , 8 @ H $ ( 0 / $ ( , . 8 ; $ ( 0 1 $ ( , 0 8
F $ ( 0 3 $ ( , 2 8 @ $ ( 0 5 $ ( , 4 8 ; @ H $ ( 0 7 $ ( , 6 8 @ $ ( 0 9 $ ( , 8 8 $ ( 0 ; $ ( , : 8 j @ H $ ( 0 = $ ( , < 8 j @ H $ ( 0 ? $ ( , > 8 @ H $ ( 0 A $ ( , @ 8 @ j H P X ` $ ( 0 C $ ( , B 8 @ $ ( 0 E $ ( , D 8 @ $ ( 0 G $ ( , F 8 $ ( 0 I $ ( , H 8 @ $ ( 0 K $ ( , J 8 @ H $ ( 0 M $ ( , L 8 @ H P $ ( 0 O $ ( , N 8 @ H $ ( 0 Q $ ( , P 8 @ $ ( 0 S $ ( , R 8 @ H $ ( 0 U $ ( , T 8 @ H $ ( 0 W $ ( , V 8 @ $ ( 0 Y $ ( , X 8 @ $ ( 0 [ $ ( , Z 0 $ ( 0 ] $ ( , \ 8 @ ; $ ( 0 _ $ ( , ^ 8 @ $ ( 0 a $ ( , ` 8 @ $ ( 0 c $ ( , b 8 @
F H P $ ( 0 e $ ( , d 8 @
p $ ( 0 g $ ( , f 8 @ H ; P $ ( 0 i $ ( , h 8 @ H $ ( 0 k $ ( , j 8 @ H ; P $ ( 0 m $ ( , l 8 @ H ; P $ ( 0 o $ ( , n 8 @ H $ ( 0 q $ ( , p 8 $ ( 0 s $ ( , r 8 @ H P j X $ ( 0 u $ ( , t 8 @ H $ ( 0 w $ ( , v 8 @ H P $ ( 0 y $ ( , x 8 @ b H j P X ` $ ( 0 { $ ( , z 8 @ H j P $ ( 0 } $ ( , | 8 @ H P $ ( ! 0 $ ( ! , ~ 8 @ j H P X $ ( " 0 $ ( " , 8 @ H $ ( # 0 $ ( # , 8 @ ; $ ( $ 0 $ ( $ , 8 @ H $ ( ( 0 $ ( ( , 8 $ ( * 0 $ ( * , 8
F @ H $ ( , 0 $ ( , , 8
p $ ( / 0 $ ( / , 8 @ ; H $ ( 1 0 $ ( 1 , 8 @ $ ( 3 0 $ ( 3 , 8 @ ; H $ ( 5 0 $ ( 5 , 8 @ ; H $ ( 8 0 $ ( 8 , 8 @ $ ( < 0 $ ( < , 8 @ H j P $ ( > 0 $ ( > , 8 @ H $ ( @ 0 $ ( @ , 8 b @ j H P X $ ( B 0 $ ( B , 8 @ j H $ ( D 0 $ ( D , 8 @ H $ ( F 0 $ ( F , 8 j @ H P $ ( I 0 $ ( I , 8 @ $ ( K 0 $ ( K , 8 ; $ ( M 0 $ ( M , 8 @ $ ( N 0 $ ( N , 8 @ ; $ ( O 0 $ ( O , 8 @ $ ( P 0 $ ( P , 8 @
F H P $ ( Q 0 $ ( Q , 8 @
p $ ( R 0 $ ( R , 8 @ H ; P $ ( S 0 $ ( S , 8 @ H $ ( T 0 $ ( T , 8 @ H ; P $ ( U 0 $ ( U , 8 @ H ; P $ ( c 0 $ ( c , 8 @ H $ ( g 0 $ ( g , 8 @ $ ( h 0 $ ( h , 8 $ ( i 0 $ ( i , 8 @ # $ ( m 0 $ ( m , 8 @ $ ( o 0 $ ( o , 8 $ $ ( s 0 $ ( s , 8 @ $ ( z 0 $ ( z , 8 @ $ ( { 0 $ ( { , 8 @ $ ( | 0 $ ( | , 8 @ $ ( 0 $ ( , 8 @ $ ( 0 $ ( , 8 @ H $ ( 0 $ ( , 8 @ $ ( 0 H ' ( , 0 8 $ ( 0 $ ( 0 ' ( , 0 ; 8 $ ( 0 $ ( , 0 $ ( 0 * ( , 0 8 $ ( 0 $ ( , 0 j H $ ( 0 , ( , 0 j 8 ' $ ( 0 0 ( , 0 8 H $ ( 0 ' ( , 0 8 ( $ ( 0 1 ( , 0 8 ) $ ( 0 2 ( , 0 8 $ ( 0 ' ( , 0 8 * $ ( 0 3 ( , 0 8 + ( ( ` , 0 8 $ ( 0 $ ( , 8
p @ H $ ( 0 $ ( , 0 $ ( 0 ' ( , 0 8 $ ( 0 4 ( , 0 b 8 P P c X h d p e f $ ( 0 $ ( , 0 8 @ H $ ( 0 $ ( , 0 t $ ( 0 ' ( , 0 t 8 $ ( 0 5 ( , 0 8 $ ( 0 ' ( , 0 t 8 $ ( 0 ( ,
0 8 X \ 7
8
9
9
9 :
9 ;
< !
" & $ # %
' + ) ( *
, / - .
0 3 1 2
4 = 8 6 5 7
9 > = ; : <
> B @ ? A
C G E D F
H 9 L J I K
M Q O N P
R 9 ? U S T
V 9 @ Z X W Y
[ = _ ] \ ^ ! "
# $ % ` d b a c & ' (
) * + e 9 A h f g , - .
/ 0 1 i 9 m k j l 2 3 4
5 6 7 n = q o p 8 9 :
; < = r 9 u s t > ? @
A B C v z x w y D E F
G H I { 9 B ~ | } J K L
M C N O P
Q R S T U V
W X Y Z [ \
] ^ _ ` a b
c d e f g h
i j k
l m n
o p q
r s t
u v w 9 D x y z
{ | } E ~
F
G G H
I
9 J
9
! "
! #
! $
% & '
! (
) * K
+ , L
- M
. / N
9 O
0 1 2
9 P
9 Q
3 R
9 S
9 4
9 5
9 6 !
" 7 8 T & $ # % ! "
# $ % ' 9 : ; + ) ( * & ' (
) * + , < 9 U / - . , - .
/ 0 1 0 = > V 4 2 1 3 2 3 4
5 6 7 5 ? @ W 9 7 6 8 8 9 :
; < = : 9 X > < ; = > ? @
A B C ? 9 Y B @ A D E F
G H I C 9 Z F D E J K L
M G 9 [ J H I N O P
Q K 9 \ N L M R S T
U V W O 9 ] R P Q X Y Z
[ S A B ^ W U T V \ ] ^
_ ` a X G G _ [ Y Z b c d
e \ C @ ` ` ^ ] _ f g h
i j k a D & a e c b d l m n
o p q f E b i g h r s t
u v w j G G c m k l x y z
{ n 3 F q o p | } ~
r 3 d u s t
v G 9 H y w x
z I J ~ | { }
K
L 9 M
N O P
Q R S
= T
b b b b b b b d b w w x x 9 e
9 f
9 g
U 9 V
W 9 X
9 h
Y 9 Z
[ 9 i
< 9 j
\ 9 ]
^ 9 k
9 _
9 `
a & l
a & m
b 9 n
9 c
d e o
[ f p
9 g
h 9 i
a & q
! h 9 j " # $
% & ' k 9 l ( ) *
+ , - k 9 m . / 0
1 2 3 n 9 o 4 5 6
7 8 9 p 9 q : ; <
= > ? r 9 s @ A B
C D E k 9 t F G H
I J K u 9 v L M N
O P Q w 9 x R S T
U V W y 9 z X Y Z
[ \ ]
{ 9 |
^ _ `
a b c } ~ d e f
g h i r j k l
m n o 9 p q r
s t u 9 v w x
y z { 9 s | } ~
! 9 # "
$ 9 ' % &
( 9 + ) *
, 9 / - .
0 9 3 1 2
4 9 7 5 6
dL4% I;f HHHl$@Hl$@H H$ HD$HD$8H
H $HD$ HD$ HD$HD$0H
H $ HD$H@ H@ = u HL$0HHHxHL$0 HD$(H
HH0= u HL$8HH8Hx8HL$8 H H$ H|$= uHD$(HH HD$( HGHH HH<$HD$PHD$HD$XHD$ HD$HL$ H|$ uRHT$8HJHHrHBH9wcH)HHH?H!HH\$`H)HL$hHT$pEWD|$xHl$@HHEWD|$`HD$p HD$xH$ Hl$@HH f dL4% I;fS HHHl$@Hl$@H H$ HD$HD$8H
H $HD$ HD$ HD$HD$0H
H $ HD$H@ H@ = u HL$0HHHxHL$0 HD$(H
HH0= u HL$8HH8Hx8HL$8 H H$ H|$= uHD$(HH HD$( HGHH HϐHD$hHG0= fu HD$`HG(HG(HHHT$` @ HHD$xHG = u HD$pHGHGHHHT$p HH<$HD$PHD$HD$XHD$ HD$HL$ H|$ u_HT$8HJHHrHBH9wxH)HHH?H!HH$ H)H$ H$ EWD$ Hl$@HHEWD$ HDŽ$ H$ H$ Hl$@HH dL4% I;f; H8Hl$0Hl$0HD$@H
H9uHL$H fuHy |H H H$HD$ HD$ HD$HD$(H
H $ HD$H@ H@ = u HL$(HHHxHL$( HL$@HH0= u HL$HHH8Hx8HL$H HD$ H
H $ H|$= uHD$ HH HD$ HGHH HH|$PHl$0H8 dL4% I;fvpHH,$H,$HD$ HL$HA0= u HD$HA(Hy(HD$ HD$0HA = u HD$(HAHyHD$( H,$HÐ vdL4% I;f! HXHl$PHl$PHD$hHt= t6HL$hH
= uHL$pH
H= HL$p HL$pHD$@HL$HHD$@Ht PӃ HH HDf111111HT$`H$HD$HL$Ht$EWD|$ HD$0HL$8H|$0 tHD$xH$ Hl$PHXHD$`H H$ HD$HL$HD$xH$ Hl$PHX dL4% I;f6 HXHl$PHl$PHD$hHt= t6HL$hH
= uHL$pH
H= HL$p HL$pHD$@HL$HHD$@Ht PӃ HH HDf111111HT$`H$HD$HL$Ht$HD$ HD$xHD$( HD$0HL$8H|$0 tH$ H$ Hl$PHXHD$`H H$ HD$HL$H$ H$ Hl$PHX dL4% Ld$M;fw H H$ H$ H$ H$ H I*ǒ Lrer H$ H D H9 H$ HHHL$@HPHT$XH HD$hH H5 H= H$HL$HT$H\$Ht$ H|$( H|$0tVH H$HD$1 EWD|$HD$ HD$(HL$0H$ H$ H$ H H$ HH $H
HL$HD$ H$ HH $HL$hHL$HL$@HL$HL$XHL$ H$ HH $H
HL$HD$ H$ H H$EWD|$HD$ HD$(HL$0H$ H$ H$ H ^= H$ H D H9 H$ HHHL$HHPHT$PH HD$`H$HL$HT$ |$ H$ HH $H
HL$HD$ H$ HH $HL$`HL$HL$HHL$HL$PHL$ H$ HH $H
HL$HD$ H H$HD$= EWD|$HD$ HD$(HL$0H$ H$ H$ H Á*ǒ H$ H H9 H$ HHT$pAD$xA$ HL$pHT$x @ Humf9xmufylu`HH{( tVH H$HD$[ EWD|$HD$ HD$(HL$0H$ H$ H$ H H $HT$ @ |$ H H
H H$ H$ H$ H $Ht$H|$HD$HL$ HT$( H|$0 H$ HH $H
HL$HD$ H$ HHT$pH\$xH $HT$H\$ H$ ~^H$ HH $D$ D H$ HH$ H$ H$ H $HT$H\$Ht$ D H$ HH $H
HL$HD$ 5 H H$HD$1 EWD|$HD$ HD$(HL$0H$ H$ H$ H H H$HD$0 EWD|$HD$ HD$(HL$0H$ H$ H$ H Ðݩ H$ H D H9 H$ HQHYHqH H$HL$HT$H\$Ht$ HD$(HL$0H|$( H$ H$ H$ H Á0͢ueH$ H H9F H$ HQHYH H5 H4$HD$HL$HT$H\$ D$( f r H$ H D H9 H$ HH$ A$ A$ A($ H$H$ HL$ HD$HL$H|$ uQH$ H H$EWD|$HD$ HD$(HL$0H$ H$ H$ H H$ H$ H$ H H H$HD$& EWD|$HD$ HD$(HL$0H$ H$ H$ H gdL4% I;f H@Hl$8Hl$8H\$XHt$HH|$P111E1IELH9 HD$(DD$'T$&HL$0D E A> L
IL)LXL% M Mj D M9 MI)IH)HHH?L!HM9t1@H $Ld$LT$ @ D$HL$0T$&Ht$HH|$PDD$'Ll$(L|$X%E1 MIIItD8u1IIA'tA"uIIDʐA< L
NL L9 L9 L9 HH)H?H!HH$L\$LL$ |$ t&HD$(T$&H\$XHt$HH|$PHL$0A 'HD$(HL$0T$&H\$XHt$HH|$PDD$'HII fA>uHtHIIIIߐD$` Hl$8H@Hu
uAE1DD$`Hl$8H@L LH LL bdL4% I;fv=H Hl$Hl$HD$(H H$ HD$HL$HD$0HL$8Hl$H dL4% Ld$M;fn H H$ H$ H$ HHPH H$HL$H$ HL$H$ H\$ HD$ HHH HH H$ H$u5H$ H $H HT$HD$ |$ H$ H$ HyP um H$= uH$ HAPH$ HyP H$= uH$ HAHH$ HyH H$ H$ H $HD$H HT$HD$ HD$(HD$HHL$ HL$xH $HD$H HT$HD$ D HD$ H|9HPHL$H H9 H)HAHHH?H!Ht$xH
H\$HHL$xH\$HHL$x @ Hu MHD$XH$HL$H\$ HD$HL$ HT$(H$HL$HT$ D$HL$xH\$Hu0H $H\$H HD$HD$ D H|$ | H
HD$HHL$xH H$ HD$PH $HD$ H HD$HD$ f |$ uHD$PH$ CH$ H HD$HD$ H$ HL$HL$PHL$ HL$(HD$0HD$HHL$xH$ HZHH5 H4$H\$HL$HD$ HD$ Hx tH$ H@ HD$xHL$HKH H$ HDŽ$ H$ HĐ H$ H$ H$ HĐ HL$HHD$xH$ HZPH5 H4$H\$H$ H\$H$ H|$ H|$ HD$HHG= u
HL$xH
HL$x H$ HZHH5 H4$H\$HL$HD$ H|$ H$ HG= u
H$ H
H$ H$ HH $H
HL$HD$ H$ HH $HL$xHL$HT$HHT$ H$ HH $H
HL$HD$ H$ H$ HD$H$ HD$ HD$HL$ HT$(H H $H$ H\$HD$HL$HT$ D$( H$ HH $H
HL$HD$ H$ HH`HQHXXHphfH9s`H H$H\$HL$Ht$HT$ HD$(HL$0HT$8H$ HSh= uHCX H{X HHHHQHP`HHD$HHD H< = u HT$xH
HL$x HH$ H$ H$ HĐ H$ H@HHH $HD$
f HD$HL$H$ HT$xHT$H\$HH\$H5 Ht$HD$ HD$(HL$0 H$ HHHHT$@HT$PH\$8H$ H5 H4$HL$H\$HT$ HD$ Hx D ;H$ HL$PoH D pdL4% I;f H8Hl$0Hl$0HD$@HHPHL$(HPHH H $HT$HT$HHT$Ht$PHt$ HD$ HH@H H$H\$(H\$HL$HD$ HD$@H@HH
H $HD$HD$HHD$HD$PHD$ Hl$0H8 .dL4% I;f HHHl$@Hl$@HD$PHH`HPXHXhHqH9s\H H$HT$HL$H\$Ht$ HD$(HL$0HT$8H\$PHSh= fuHCX H{X HHHYHX`HHD
H<
= u
H
1 Hl$@HH "dL4% I;f HHHl$@Hl$@HD$P Ht$(HL$0HPPHT$8HXHH= H<$H\$HL$Ht$ HD$ HH@H H$H\$8H\$HL$HD$ HD$PHHHH H$HL$HL$0HL$HL$(HL$ HD$PHH`HPXH~ HHHHt
H
HX`H2Hl$@HH dL4% L$M;f H H$ H$ H$ Ht]Hx uVH H$HD$4 EWD|$HD$ HD$(HL$0H$ H$ H$ H H$ H H$ HtkHZ8saH$ H$H$ HT$HL$ |$ uH$ H$ H$ EWD$ H$ H H$ H$ OEWD$ H$ H H $Ht$H|$ H\$Ht$ HL$(H$ H$ HH H$ Ht @ H HwLAIv2f D Ht$ HvHu H> f)H ^sHHHAEWD$ H$ H H$ H$ H$ H $Ht$H|$ HD$HL$ HT$H$ H0 H$ H$@ HD$hH` uJH H HpxH $HT$H\$ր|$ N HD$hH$ H$@ H$ r H` H$ H$H$ HL$H\$ HD$(HL$HT$ H7 H` tH$ H` pH$ H$8 H$0 H $HT$HD$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ H$ H` HD$hH$ H$@ H$ tVH H HpxH $HT$H\$ր|$ / H$ HD$hH$ H$@ H$ H$ H$H$ HL$H\$ HD$(HL$HT$ H H` ubH$0 H$ H$8 H $HT$HD$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ HD$hH$ H$@ H$ H$ HtHuSHPHH $HD$HL$H H $H|$H$ H$@ H$ H$ HD$h1@t4H$ H$H$ HL$H\$ HD$HD$p1 H$HL$ HD$HL$HT$H\$ H H$ H$ H$ HDŽ$H H$P EWD:H$` EWD:H$p EWD:H$h H$ H/ H H* Hr HzHt/LB(HR0L$H H$P H$X H$` f H$H$ HD$H$ HL$H$ HT$D$ HD$(HL$0HT$8H$HL$HT$D$ @ HD$(H
H9L$ uHHXHpHx u&Ht H$H H$P H$X H$` H$ H$ H$ H>LFLNLVH$H L$P L$X L$` H~ Hv(H$ HwE1IH$( H H$HT$EWD|$Ht$ HT$(HD$8H$ H$( IL$ H$ H H$HT$Ht$H|$Ht$ H$ H$h H$ H$p H$ H$x H$ H$ H$ H$` u=H$ Ht0Hr(Hz0LBHR H$H H$P L$X H$` H$` uSHD$hH H$ H $fHD$HL$Ht;H$X H$` H$ H$ H$ HPH$ 1F H H$ HD$H$@ H= uH$ HHHxH$ H
H$ H$ H$ H H$ H$ H$ H H$0 H$H$8 HL$H$ HT$D$ HD$ HL$(H$ H H$HD$ HD$H$@ H$0 H $H$8 HL$H$ HL$ HD$HL$ H$HL$H$ HD$H$ HD$ HD$ H$ D$($ D$8$ D$H$ H$ H$H$@ HD$H$ HD$H$ HD$$ D$ $ D$0$ D$@ HD$PHL$XH$ H$ H$ H H$ H$H$ HD$H$ HD$D$ HD$ HL$(H$ H H$HD$ HD$H$ H$@ H $H$ HL$H$ HL$H$ HL$ HD$ H$ D$($ D$8$ D$H$ H$ H$H$ HD$H$ HD$H$ HD$$ D$ $ D$0$ D$@ HD$PHL$XH$ H$ H$ H H$0 H$H$8 HL$H$ HT$D$ HD$ HL$(H$ H H$HD$ HD$H$@ H$0 H $H$8 HL$H$ HL$ HD$HL$ H$HL$H$ HD$H$ HD$ HD$ H$ D$($ D$8$ D$H$ H$ H$H$@ HD$H$ HD$H$ HD$$ D$ $ D$0$ D$@ HD$PHL$XH$ H$ H$ H H$ H$H$ HD$H$ HD$D$ HD$ HL$(H$ H H$HD$ HD$H$ H$@ H $H$ HL$H$ HL$H$ HL$ HD$ H$ D$($ D$8$ D$H$ H$ H$H$ HD$H$ HD$H$ HD$$ D$ $ D$0$ D$@ HD$PHL$XH$ H$ H$ H HH9 HxL@L9 LkXN MT88AfsH$ Ht$xL$ L $H$ HD$H$ HL$H$ HT$D$ H$ H$ HT8H\$(Ht$0H|$8r1ZH$ H$0 H$ H $Ht$H|$ D$H$ H$0 H$ H$ H$ t-H$ H$ H$ H$ Ht$x HH Hu2H> u,H$ H$ H$ H$ Ht$xfH|(LD0LLHD H$ H $L$H LT$H|$LD$LL$ HD$(H\$0Ht$8HT$@ HD$HHL$PH|$H u*H$ H$ H$ H$ Ht$xH$ H$ H$ H H$ H$H$H HL$ HD$HL$H|$ > H$ HuWH$ H$H$ HL$H$ HL$H$ HL$H$ HL$ HD$(HL$0H H$ H$H$@ HL$H$ HL$H$ HL$H$ HL$ H$ HL$( @ HD$XHL$0HT$8H\$`Ht$@H|$HLD$PLL$@HucMt3H H$H$ HD$Ht$H|$LD$ D$( H$ H$HL$HT$ H$ H$ H H$H H$P H$X H$` H$ H4$HD$HL$HT$H\$ f HD$(HL$0H|$( t H$ H$ H$ H H$ H H$EWD|$HD$ HD$(HL$0H$ H$ H$ H H$ H$ H$ H H$ H$ H$ H HL H$ HJHD$pH9 H$ H$ H$H$ HT$H$ H\$HL$ HD$ HL$(HT$0H$ H $HD$HL$HT$H$ HD$ H$ HL$( HD$0HL$8H|$0 fMH$ H$ H$ H EWD$ H$ H H H$ HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH$ HHH
H $HD$ dL4% L$M;f_ H H$ H$ H$8 f D H H` t1^H$( H $H$0 HT$HD$ HD$H
H H\$ H@xH $HL$HT$D$H$8 r H` H$( H $H$0 HT$HD$ HD$(HL$HT$ H H` t1{H$ H$ H$ H $HT$HD$ D HD$H
H H\$ H@xH $HL$HT$D$H$ H$ H$ H$8 H` t1^H$( H $H$0 HT$HD$ HD$H
H H\$ H@xH $HL$HT$D$H$8 H$( H $H$0 HT$HD$ HD$(HL$HT$ HT H` t1}H$ H$ H$ H $HT$HD$ HD$H
H H\$ H@xH $HL$HT$D$H$ H$ H$ H$8 HH HtH HH$ wHP @ Hv2Ht2 Hv!HuH$0 H8 >H s
H$0 (s
H$0 H H$0 HHu,H$( H$HD$HL$ HD$HL$ HT$(0EWD$@ H$ H HH$( H$0 HT$hH$ H$ HH Ht1^H$HL$H\$ HD$HL$ H@HH $HD$HL$H H $H|$H$ H\$hH$ t$H$HL$H\$ HD$HD$p1
H$HL$H\$ HD$H
HT$ H9 u H$HT$HL$ |$ o H$ H$H$ HL$HT$hHT$ HD$HL$ H$ H$HD$HL$H$ HD$H$ HD$ HD$hHD$( HD$XHL$`HT$@H\$HHt$0H|$8H|$X @ Ht$H$ HT$H\$ Ht$H|$ H$( EWD8H$8 EWD9H$H EWD9H$ H$( H$ H$0 H$ H$8 H$ H$@ H$H H$P H$ HQ(HY Hq0HzH9sjH H$H\$HT$Ht$H|$ HD$(HL$0HT$8H$ HS0= uHC H{ f HHHH$( HrHq(H RHH = u,$( H H@$8 $H @H
H $HT$HD$ EWD$@ H$ H H$@ H$H H$ H H$ H$H$ HD$HD$hHD$D$f HD$(HL$ H$ EWD:H$ EWD;H$ EWD;H H9j
$ @$ @ $ H$ HH(Hp Hx0LAL9s^H $Ht$HL$H|$LD$ HD$(HL$0HT$8H$ HS0= uHC H{ H$ HHHYHX(HIHH = u,$ HH@$ $ @H H$HL$HT$ EWD$@ H$ H H $HT$HD$D$ HD$ HL$(H$ H H$HD$ HD$H@H$ H $HD$ HL$(HT$H\$H|$ H$X EWD8H$h EWD9H$x EWD9H$ H$X H$ H$` H$ H$h H$ H$p H$ HT$H\$ HD$HL$ H$x H$ H$ HH(HP HX0HqH9s]H H$HT$HL$H\$Ht$ HD$(HL$0HT$8H$ HS0= uHC H{ HHHYHX(HIHH = u,$X HH@$h $x @"H H$HL$H$X HD$ EWD$@ H$ H H$@ H$H H$ H H$( H $H$0 HL$HD$D$ HD$ HL$(H$ H H$HD$ HD$H@H$ H $HD$ HL$(HT$H\$H|$ H$ EWD8H$ EWD9H$ EWD9H$ H$ H$ H$ H$ H$ H$ H$ H$ HT$H\$ HD$HL$ H$ H$ H$ HH(HP HX0HqH9s]H H$HT$HL$H\$Ht$ HD$(HL$0HT$8H$ HS0= uHC H{ HHHYHX(HIHH = u,$ HH@$ $ @"H H$HL$H$ HD$ EWD$@ H$ H H$@ H$H H$ H H $HT$HD$D$ HD$ HL$(H$ H H$HD$ HD$H$ EWD9H$ EWD9H$ EWD9H@H$ H $H$ HL$H$ HL$H$ HL$H$ HL$ HD$XHL$`H|$X D$($ D$8$ D$H$ $ $ $ $ $ $ H$ H$ HH(HP HX0HqH9s]H H$HT$HL$H\$Ht$ HD$(HL$0HT$8H$ HS0= uHC H{ HHHYHX(HIHH = fu,$ HH@$ $ @"H H$HL$H$ HD$ EWD$@ H$ H H$@ H$H H$ H H$( H $H$0 HL$HD$D$ HD$ HL$(H$ H H$HD$ HD$H$ EWD9H$ EWD9H$ EWD9H@H$ H $H$ HL$H$ HL$H$ HL$H$ HL$ HD$XHL$`H|$X D$($ D$8$ D$H$ $ $ $ $ $ $ f H$ H$ HH(HP HX0HqH9s_H H$HT$HL$H\$Ht$ HD$(HL$0HT$8H$ HS0= uHC f H{ HHHYHX(HIHH = u,$ HH@$ $ @"H H$HL$H$ HD$ EWD$@ H$ H H$@ H$H H$ H H $H\$H HD$ HT$xHJHD$pH9 HL$xH$ H$H$ HT$H\$hH\$HL$ HD$ HL$(HT$0H$ H $H$ Ht$H$ H|$L$ LD$L$ LL$ L$ LT$(HD$0HL$8HT$@ HD$HHL$PH|$H @ -H$@ H$H H$ H EWD$@ H$ H H H$ HD$H@ H
HH$ HHH
H $HD$ H H$ HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH@ H
H $HD$ H H$f HD$H@ H
HH@ H
H $HD$ {dL4% Ld$M;f H H$ H$ HDŽ$ H$ EWD8H$ EWD8H$ EWD8HD$` HD$hEWD8HD$xEWD8H$ EWD8H$ H$ H HHYHqHyHT$`H\$hHt$pH|$xHQ HI(HL$HHw1@HT$XH H$HD$EWD|$HL$ HD$(HL$8HT$XHHL$HH\$@HD$PH5 H4$HD$HL$HT$HL$ HD$PH$ HD$HH$ HD$@H$ H$ Ht/HH HPHt!HT$pHL$xHH(H@0HL$`HD$h H$ H H$ H$H|$ t3H$ H H$ H $HD$HL$HD$pHL$xEH$ H@HH$ H $HD$HL$H H $HD$HL$HD$pHL$xHD$`H$ D$h$ D$x$ $ $ H$ HĠ LdL4% Ld$M;f H H$ H$ H$ HHxHPpH HqH9sbH H$HT$HL$H\$Ht$ HD$(HL$0HT$8H$ H = uHCpf H{p HHHYHXxHHD
HD
H<
H
H[= uH
HD
1 H HHxHL$XH$ HRHXH$ H4$H\$H$ H\$$ D$$ D$($ D$8HD$HHL$PH|$H ~ H$ H H\$XH9Xx6 H$ HtHIH $H$ HD$ @ HD$HL$H$ HZxH\$XHt$`EWD>H|$pEWD?H$HL$ HD$H
HL$`HD$hH$ HPpH@xH\$XHH9 HHDHLH$HL$ HD$H
HL$pHD$xH H$HD$5 HD$`HD$HD$ HD$ HD$(HL$0H$ H$ H$ HĈ HKH9rAHHxEWD$ H$ HĈ H$ H$ H$ HĈ HH dL4% I;f1 HHHl$@Hl$@HD$PH$HL$hHL$ HD$HL$H|$ HD$XH@HL$`H $HD$ HL$(HT$H\$Ht$H|$ tH$ H$ Hl$@HHÐH H$HD$PHD$HT$H\$Ht$ D$( HD$hHL$pHT$xH$ Ht$PH4$HD$HL$HT$H\$ HD$(HL$0H$ H$ Hl$@HHH$ H$ Hl$@HH dL4% Ld$M;f H H$ H$ H$ HHHPH H$ HsxLCpL LVLL`M9 HL$XHT$pL\$hLd$PH H$LD$Ht$LL$LT$ HD$(HL$0HT$8H$ H = uHCp H{p HT$pL\$hLd$PIHH$ HL$XLNLKxHMd0IL0J<I 0HI= u M 0IT0L H HK`HQHsXLChfI9sbH H$Ht$HL$LD$HT$ HD$(HL$0HT$8H$ HSh= uHCX H{X HH$ HQHS`HHD H<= u
H 1 H $HD$ H$ HH $D$< H$ HH$ HZHrH $H\$Ht$ H$ Hx ttH$ HH $H
HL$HD$ H$ HHPH$ H $HL$HT$ H$ HH $D$" H$ HH(H@ fH~bHL$X1 H H$HD$ EWD|$HD$ HD$(HL$0H$ H$ H$ Hİ H$ H H$D$> D EWD$ H$ Hİ H0 D$x@$ @ $ H$ H$ H|$xL$ HL H|$pLD$hHT$PHD$`Ht$HH\$@H$ HH $D$ f HD$@HtaH$ H $HT$pHT$HD$ H$ HHT$H\$ H $HT$H\$ H$ HH $D$: H$ HH $HL$hHL$HL$HHL$ H$ HH $H
HL$HD$ @ H$ H$ H$ H$HD$HL$ H$ HH $D$" HD$`HL$XHT$PH D H9Y dL4% Ld$M;f H H$ H$ H$ f H H$ HQpHYx H\ HHHtH|f D H< Ht$HH|$hLDLD$@HHT$`H$ L9r H$H$ HD$LD$ |$ % H$ HL$HH9 HD$hH$H$ HT$HL$ |$ H$ H HXxHKH9h HHxH$HD$ H$ HH $D$< H$ HH $D$/ H$ HH $H$ HL$H$ HL$ H$ HH $D$> H$ y H$ HT$`H$ Ht$HH|$hLD$@'H$ HL$HHT$`H$ HH|$hLD$@H9u.H<$H$ HD$Ht$ |$ H$ H$ EWD9H$ EWD:H$ H$HD$ HD$H
H$ H$ HD$hH$HD$HHD$ HD$H
H$ H$ H H$HD$0 H$ HD$HD$ HD$ HD$(HL$0H$ H$ H$ H H$ EWD8H$ EWD9H$ EWD9H$ EWD9H$ H $H$ HL$ HD$H
H$ H$ H$ H$H$ HD$ HD$H
H$ H$ HD$hH$HD$HHD$ HD$H
H$ H$ HD$`H$HD$@HD$ HD$H
H$ H$ H H$HD$P H$ HD$HD$ HD$ HD$(HL$0H$ H$ H$ H EWD|$pH$ H $HD$ HD$H
HL$pHD$xH H$HD$$ HD$pHD$HD$ HD$ HD$(HL$0H$ H$ H$ H H H$HD$ EWD|$HD$ HD$(HL$0H$ H$ H$ H Ht$8HL$PHPPHT$XHXHH= H<$H\$HL$Ht$ HD$ HH@H H$H\$XH\$HL$HD$ H$ HHHH H$HL$HL$PHL$HL$8HL$ H$ HH`HPX @ H~$HHHHt
H
HX` @ H'EWD$ H$ H JdL4% I;f` HpHl$hHl$hH$ HH H . D H HHH Hw$fHu
H$ H AH$ H2HuH$ H Hu
H$ Hc H$ HH$HD$
HD$HL$H$ H$ EWD$ HDŽ$ EWD$ Hl$hHpHT f D H w3Hu
H$ H PHu
H$ =H$ 0H
u H$ H u
H$ H H$ HH$HD$
HD$HL$H$ H$ EWD$ HDŽ$ EWD$ Hl$hHpH$ H$H$ HD$HL$ |$ t H
H
H$ H$ EWD$ HDŽ$ EWD$ Hl$hHpH; H H
uH$ Z H$ D$@H$ H$HD$HL$ HD$HL$ H@(H $HD$D$@$D$gHD$HD$ @ HD$ HL$(H$ H$ EWD$ HDŽ$ EWD$ Hl$hHpH H$ H@HH$ H $HD$HL$H H $H|$ H$ H$ H $H$ HT$HD$ HD$H$ H $H$ HL$H$ HL$HD$ HD$ HD$(HL$0HT$8H$HL$HT$ HD$HL$ HT$(3 H$ H $H$ HT$HD$ HD$HD$HH
H $HD$HD$ HD$HD$PH$HL$HHL$HL$ HD$= t.H
H
= u H H= H
HL$XHD$`HL$XfHt QӃ HH HDf111H $HD$Ht$H$ HD$H$ HD$ H$ HD$( HT$HHHD$PEWD$ H$ H$ H$ EWD$ Hl$hHpHt{H H$ H$H$ HD$HL$ @ HD$HL$ H$ H$ EWD$ HDŽ$ EWD$ Hl$hHpH$ H@HH$ H $HD$HL$H H $fH|$ H H$ HD$H$ H= uH$ HHHxH$ EWD$ EWD$ HDŽ$ H
H$ H$ Hl$hHpH$ H$H$ HD$H$ HD$ HD$HL$ HT$(EWD$ H$ H$ H$ EWD$ Hl$hHp dL4% I;f3 H@Hl$8Hl$8HD$HHL$XHT$P"H$HT$H\$ HD$HT$ HL$(HH @ Ht
HuxHHL$0wHq D Hv#HtoHvHu H: HuT rsH
HHgHD$`HT$hH\$pHl$8H@HD$`HT$hH\$pHl$8H@H H$ HD$H@ H
HHL$0HHH
H $HD$ dL4% L$8M;f6 HH H$@ H$@ EWD$ EWD$0 H$P H$ H$X HsH$ 1 Hf H9 H{HKH9 LkXN MT88ArHD$hL$ H$ L$ L $H$` HD$H$h HL$H$p HT$D$ D HD$8HL$0HT$(Hu"HD$hH$P H$X H$ 9H$ H$ H$ H$ H$ H| 8HH f Ho H$HL$HD$ HD$ H$ HL$(H$ HT$H$ H$HD$HL$D$ HD$ HL$ HT$(H\$(H @ =~.8uiH H9uTHBHJHH$P H3H4$HT$HD$HL$ @ HD$hH$P H$X H$
H l=\uUH fH9uWHCH H$P HH $HL$HD$ HD$hH$P H$X H$ H H H$ H$ H$ H tHA HD @HL HHT PH$ H $HD$HL$HT$ HD$ HL$(H|$ H$ H$H$ HD$H$ HD$ HD$(HD$pHL$H$ HT$ H$ HH H$ Hu pHt1fH $HT$H\$ HD$HL$ H@HH $HD$HL$H H $H|$H$ H$ H\$pH$ @C H $HT$H\$ H|$ u"HD$hH$P H$X H$ H$P H$HD$ H$P HH $H
HL$HD$ H$ H HX H$ H$H$ HD$HD$pHD$ HD$H$ HL$ HL$`H$HL$H HT$HD$ HL$`HAHT$ H9 H$ \fH}7H$ \$WH$P HH $HD$HL$ H$ \$W-H H$ H$H$ HD$HD$pHD$ H H
H H\$ H\$xHt$(H$ H|$H$ H<$H\$Ht$HD$HL$ HT$( HL$xHAHT$0fH9 H$ \HuDH$ \$WH$P HH $HD$HL$H$ HD$ H$ \$W-Hs tH$P HH $D$ H$P HH $H
HL$HD$ HD$hH$P H$X H$ W H HD @HL HHT PH$ H<$HD$HL$HT$ HD$ HL$(H|$ H$ H$ HTHH\@HDPH$0 H9 H$ HH HtHuH$ HwLFIv7Ht
fHv$HuH$ H> A7fH
r*s
H$ L H$ IMAEuxH$ H4$H)HHHHH?H!H HD$H)HT$Ht$ HD$ HL$(H|$
H$ H$ fH$ H$ HH$ H HuHH D Hu H= H= H$ HD @HL HHT PH$ H $HD$HL$HT$ HD$ HL$(H|$ H$ H` t1fH$ H $H$ HT$HD$ HD$H
H H\$ H@xH $HL$HT$D$H$ H$ H $H$ HT$HD$ HD$(HL$HT$ H H` t1wH$ H$ H$ H $HT$HD$ HD$H
H H\$ H@xH $HL$HT$D$H$ H$ H$ 0 H H$ HD$H$ H$ H $H$ HL$H$ HL$ D HD$ HL$(HT$HH @ H [ H HQ H Hr H w&f D HuH -Hu " D H
u H uH H H$ H $HD$ HD$@ HD$HD$
H$ HHL$(H\$0Ht$8H= H<$L$P LD$HL$H\$Ht$ HD$(HL$0H|$( @ HwHuH H HuH HuHc H H$ H $HD$ HD$@ HD$HD$
H$ HHL$(H\$0Ht$8H= H<$L$P LD$HL$H\$Ht$ HD$(HL$0H|$( H$HD$H\$ |$ tH$ true H$ fals@e H$ HH5 H4$H$P H|$HD$HL$HD$ @ HD$(HL$0H|$( G v HV H H H$HD$H\$ HD$HL$ H$ HD$HL$ H$ HHL$H\$ Ht$(H= H<$L$P LD$HL$H\$Ht$ HD$(HL$0H|$( H$HD$H\$D$ HD$(H
H9L$ u
HHpHx < H$ HH
H $L$P LD$H\$Ht$H|$ HD$(HL$0H|$( g H
D H
u
Z D$XH$HD$H\$ HD$HL$ H@(H $HD$H$ H $HD$ HD$@ D$XD$D$ gHD$(HD$0 H$ HHL$8H\$@Ht$HH= H<$L$P LD$HL$H\$Ht$ HD$(HL$0H|$( HD$hH$P H$X H$ H $HT$HD$D$ D HD$ HL$(H$ H H$HD$ HD$H@H$ H $HD$ HL$(HT$H\$Ht$H|$ 3 H$ HH= H<$L$P LD$HT$H\$Ht$ HHD$(HL$0H|$( HD$hH$P H$X H$ H$ H $H$ HL$HD$D$ HD$ HL$(H$ H H$HD$ HD$H@H$ H $HD$ HL$(HT$H\$Ht$H|$ @ u H$ HH= H<$L$P LD$HT$H\$Ht$ HHD$(HL$0H|$( HD$hH$P H$X H$ H$P H $HT$HL$HD$H$ HD$ HD$( HD$0HL$8H|$0 D HD$hH$P H$X H$ LH H$HD$# EWD|$HD$ HD$(HL$0H$x H$ H$@ HH H$` H$H$h HD$H$p HD$ HD$HL$ EWD$ HtH@H$ H$ H H$HD$% H$ HD$HD$ HD$ HD$(HL$0H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$x H$ H$@ HH H$ H$EWD|$HD$ H$P H H$EWD|$HD$ HD$(HL$0H$x H$ H$@ HH H H$ D HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH$ HHH
H $HD$ @ H H$H HD$ dL4% I;fvTH@Hl$8Hl$8HD$HH H$EWD|$HD$ @ HD$(HL$0HD$PHL$XHl$8H@ dL4% I;f H@Hl$8Hl$8HD$HHx0 uHx u
Hl$8H@HL$PH} HH8x@ u@@ @@ Hl$8H@ÀxA u@A HH $D$
f HD$HHL$PHP0HX(H~ HH $H\$HT$ HD$HHL$PHx ~1QH~H@8@@Hl$8H@HT$0HHPHX H $HT$H\$ @ HD$0HPHD$HHL$PH9P8H dL4% I;fc HPHl$HHl$HH\$hHt$XH|$`1LD$8I@H\$hHt$XH|$`HD$8H9~ULFf D H9F~EHHLLLM\ N M9u)L$LD$LL$ |$ uHL$8Ht$XHH^HH|$@H_HL$8Ht$XH9|uHVH~f H9 H\$@HHH<HTH$EWD|$H|$HT$ HD$(HL$0H|$( tHD$xH$ Hl$HHPHVH9wHNEWD|$xHl$HHP HH D {dL4% Ld$M;f H H$ H$ 1 HT$@HBH$ H9 HD$@HD$` HL$hEWD9HL$xEWD9H$ EWD9HH$ H HDHD$xH\$pH$ HH $H\$`H\$ HD$HL$H|$ XH$ H$ H$ HĠ H$ HCH HL$PHsH{H9sMHD$HH H$H|$HD$Ht$HL$ H|$(Ht$8HD$HHL$PH$ H$ H9 H|$XHt$HH
H $HH)HH?H!HHD$HT$H$ HD$HT$ HD$PH$ HAHD$HHA= u HD$XHAHyHD$X EWD$ H$ HĠ f dL4% I;fv{H@Hl$8Hl$8HD$HHH@H H$HD$HL$H$ H HT$HD$ HD$HL$ HD$(HL$0HD$PHL$XHl$8H@ ldL4% I;f H0Hl$(Hl$(HD$HHH Hm H HtmH- f D Hw Hu
HD$@H 5HL$@H)Hu HL$@HHu
HL$@HcHL$@HHD$PHl$(H0HD$8H$HD$@HD$HL$ D$D$PHl$(H0H wtH w0 @ Hu
HD$@H HHu HL$@f6HL$@,H
uHL$@ D H u
HL$@HHL$@HHD$PHl$(H0H
uHD$@ Z HD$@ Wf.!L$PHl$(H0HwH Ht D H HuzHHD$ fwHPHv.Ht Hv HuHD$@H8 -Hu| fs1s
HD$@H HD$@HD$PHl$(H0Hw2HD$8H$HD$@HD$HL$ H|$ D$PHl$(H0D$P Hl$(H0H H$ HD$H@ H
HHL$ HHH
H $HD$ @ dL4% I;f H8Hl$0Hl$0H H$ H|$HD$HHGHD$PHG= u
HD$@H
HD$@ HG HG H H$H|$ HD$H$HD$XHD$HD$`HD$HD$ HD$ HL$(HD$hHL$pHl$0H8 #dL4% I;fvWH8Hl$0Hl$0HD$@H$HD$HHD$HD$PHD$HD$ HD$ HL$(HD$XHL$`Hl$0H8 dL4% I;fZ HPHl$HHl$HHD$`Ht= t6HL$`H
= uHL$hH
H= HL$h HL$hHD$8HL$@HD$8Ht PӃ HH HDf111111ɐHH HtEH H$ HD$H@ H
HH
HL$xH$ Hl$HHPH$HL$HT$ HD$HL$ HT$(H\$XH $HD$HL$HT$HD$pHD$ HD$(HL$0HD$xH$ Hl$HHP HD$HD$HD$HD$ dL4% I;f HpHl$hHl$hHD$xHD$XH$ HD$`HD$X Ht H
11HD$PHL$HH H$H|$ t;HD$HH HL$PH $HD$HL$H$ H$ Hl$hHpHD$HH HL$PH $HD$HL$H$ H HT$HD$ HD$HL$ H HD$(HD$0 HD$8HL$@H$ H$ Hl$hHp dL4% Ld$M;f H H$ H$ H$ H fH Hy uHHHt HzftH H|$`H Ht H= u H 3 ,HL$XH H$ HT$H$ HL$XH|$`HB H= uHHH H H H$ HH$ A$ A$ A($ H$ HRH$ H $HD$H$ Ht$$ D$$ D$($ D$8HD$HHL$PHT$HH$ H H H H HtRHzuKH2= u H H = u H2H Hf H|$` H$ H$ H$ H ÐH HtpHxuiH= u H H = u HH H H|$` EWD$ H$ H H$ HtH@H$H$ HD$ HD$HL$HT$hEWD:H\$xEWD;H$HL$ HD$H
HL$hHD$pH$ HPH@H$HD$ HD$H
HL$xH$ H H$HD$8 HD$hHD$HD$ HD$ HD$(HL$0H$ H$ H$ H EdL4% I;f HĀHl$xHl$x 111HHHB HD$HHL$XHT$PH\$pH$ H$ HD$HL$ HT$H\$Ht$H|$ H B=ݩuCH H9u&Ht$HHH HHT$PHL$XHt$p_H G D =0͢ H H9 HKHH\$HHtHL$XHT$PHt$p @ Ht$PH<H|$`LD$XI9rLL$pRHL$@HT$hH H$HL$pHL$Ht$LD$H|$ H\$(HL$8HT$hHt$PIIHL$@LD$XLL$pI1H$HT$HL$ H H\$HHL$XHT$`Ht$pWH f@=ru2H H9u-Ht$HHH HHT$PHL$XHt$pH H H\$HHT$PHL$XHt$p H H\$HHT$PHL$XHt$pH$ H$ Hl$xHH$ H@H$ H4$H\$HT$HL$HD$ HL$(H$ H$ Hl$xH *dL4% L$XM;f H( H$ H$ H$H HH H
s
H$@ s
H$@ HH$@ H H H$8 H$HD$HL$ HD$HL$ H@HH $HD$HL$H$HL$ HD$HL$HT$ H$8 H $H$@ Ht$H$H H|$HD$HL$ HT$( H$@ H$H H$8 H$HD$HL$ HD$HL$ HT$(HH$8 H$@ HG HD$xHT$`H$ H` uaH$HL$HT$ D HD$H
H H\$ H@xH $HL$HT$Ѐ|$ HD$xH$ HT$`rH` D H$HL$HT$ HD$(HL$HT$ HA
H` t
HD$`H` lH$ H$ HD$pH $HT$HD$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ f
HD$`H` HD$xH$ HT$`teH$HL$HT$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ HD$`HD$xH$ HT$` H$HL$HT$ HD$HL$ HT$( H H` u_H$ H$ HT$pH$HL$HT$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ HD$xH$ HT$`H$HL$HT$ HD$HL$ H H $H|$t1YHD$xH$H$ HL$HT$`HT$ HD$HL$ H@HH $HD$HL$H H $H|$n HD$xH$H$ HL$HT$`HT$ HD$HD$hHL$xH $H$ HT$H\$`H\$ HD$HL$ H@HH $HD$HL$H$HL$ HD$HL$HT$ EWD$ HDŽ$ H$ H$ H$ HD$xH$H$ HL$HT$`HT$H$ H\$HD$ HD$( HD$0HL$8HT$@H\$xH $H$ Ht$H|$`H|$HD$HL$ HT$( @ HD$xH$H$ HL$HT$`HT$H\$hH\$ HD$ HL$(HT$0H$0 H $HD$HL$HT$$P D$ $` D$0$p D$@ HD$PHL$XH|$P toH$ H$ HD$xH$H$ HD$HD$`HD$HD$hHD$ H$ H$ H$ H$ H$ H( EWD$ H$ H( HD$xH$H$ HL$HT$`HT$ HD$H
HT$ fH9 uH$HT$HL$ |$ uvH$p H$x H$ HD$HL$ HD$xH$H$ HD$HD$`HD$ HD$0HL$8H$ H$ H$ H( $P $ $` $ $p $ H H$H$ HD$ HD$HL$H|$ tr= t%H = u H
H= H$ H$ H$ Ht PӃ HH HDf111111HT$xH$H$ HT$HT$`HT$HD$HL$ Ht$( EWD$ H$ H( H$ H$H$ HD$HD$pHD$D$ HD$ HL$(H$ H H$HD$ HD$H$ H$p H$x H$ HL$HT$ H$ H@HL$HT$ H\$(H$ H4$HL$HT$H\$HD$ HL$(H$ H$ H$ H( HD$xH$H$ HD$HD$`HD$D$ HD$ HL$(H$ H H$HD$ HD$H$ H$p H$x H$ HL$HT$ H$ H@HL$HT$ H\$(H$ H4$HL$HT$H\$HD$ HL$(H$ H$ H$ H( H$ H$H$ HD$HD$pHD$D$ D HD$ HL$(H$ H H$HD$ HD$H@H$ H $$P D$$` D$$p D$(HD$8HL$@H$ H$ H$ H( HD$xH$H$ HD$HD$`HD$D$ HD$ HL$(H$ H H$HD$ HD$H@H$ H $$P D$$` D$$p D$(HD$8HL$@H$ H$ H$ H( H H$ HD$H@ H
HH@ H
H $HD$ H H$ @ HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH@ H
H $HD$ f dL4% L$M;f. H H$ H$ H$ f D H H$ H$ HD$HL$ HT$H\$H|$ H$ H$ H H$ HD$HDŽ$ H$ EWD9H$ EWD9H$ EWD9H$ H H9u9H$ H3H$X C$` C$p C($ <HDŽ$X H$` EWD;H$p EWD;H$ EWD;H$X H$ $` $ $p $ $ $ = u5H$ H$ @$ @$ @(H9ѐKH$ H
H $HD$H$ HL$ H$ H
H9H$ H H$ H$ HH HuxH$ H9 trH$ H$HL$HT$ HD$ HL$HT$(HH Hu rCsHHHu0H$ H$ H$ H$ HHH$ HH H sHHH H$p H$` H$ H $HD$HT$ HD$HL$ H@HH $HD$HL$H$HL$ HD$HL$HT$ H$p H $H$ Ht$H$` H|$HD$HL$ HT$( H$ H$p H$` H $HD$HT$ HL$HD$ H\$(HH* H$ H$x H\$pH` ubH $HD$H\$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ N H$ H$x H\$pr H` H $HD$H\$ @ HD$(HL$HT$ H) H` t
HD$pH` rH$ H$` H$ H $HT$HD$ D HD$H
H H\$ H@xH $HL$HT$Ѐ|$
HD$pH` H$ H$x H\$pthH $HD$H\$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ HD$pH$ H$x H\$p H $HD$H\$ HD$(HL$HT$ H3( H` ubH$` H$ H$ H $HT$HD$ HD$H
H H\$ H@xH $HL$HT$Ѐ|$ ? H$ H$x H\$pHH HwXHsH
v^f H H$ H$ HD$HL$H$ H$ H$ H H HuK111E1E1E1E1E1E1E11H$ 1H$ 1H$ 1H$ 1P
H H $HD$HT$ HD$HL$ H H $HD$HL$H$ H HT$HD$
HD$HL$ HD$(H$ HL$0H$ H H$ H|$H$ HG= u
H$ H
H$ H H$ H$ H$ H H $HD$HT$ HD$H
HT$ H\$Ht$ H9 u>H$ H$ H$HT$HL$ |$ H$ H$ H $Ht$ HD$HL$HT$ H|$ f H$ H D H H$ HJ HZ H
H$ H~H9Nt 5H $H|$HL$ D$H$ H$ H$ HBHJ HVH^H$ H5 Ht$HD$ HD$HL$ H HD$(HD$0 HT$8H\$@H HD$HHD$P HD$XHL$`H$HL$ HD$H
H$ H$ H$ H H$ HJ0HZ(HtGH>H9Nt 9H $H|$HL$ D$H$ H$ H$ 1Ʉ H$H$x HD$H$ HL$HT$pHT$D$ HD$(H$ HL$0H$ HT$8H$` H$HL$HT$D$ H H9D$ H$ H$HL$ HD$HL$H|$ tq= t'H = fu H
H= H$ H$ H$ HtPӃ HH HD111111H$ H$H$ HT$H$` HT$HD$HL$ Ht$( H$ H$ HZ(HR H H$X 1% HBHJ HZ(HR0H$ H5 Ht$HD$ HD$HL$ H HD$(HD$0 H\$8HT$@H HD$HHD$P
H$ HHH HT$XH\$`Hu<H$ HT$H\$H HD$HD$
@ HD$(HL$0+H$ HT$H\$HD$HL$ HD$(HL$0H$HL$ HD$H
H$ H$ H$ H H$ H$ H$ H H$ H
H $HD$ HD$HL$H|$ tp= t&H = u H
H= H$ H$ H$ HtPӃ HH HD111111H$x H$H$ HT$HT$pHT$HD$HL$ Ht$( 111E11E1E1E1E1E11E111H$ 1H$ 1H$ 1H$ 1
H $HD$HT$ HD$HL$ H@HH $HD$HL$H H $H|$ur111E1HT$pE1E1E1E1E1H$x E1H$ 1H$ 1H$ 1H$ 1H$ H$ H$x HT$pR H$x H$H$ HL$HT$pHT$ HD$H$ H$x H $H$ HT$H\$pH\$ HD$HL$ H@HH $HD$HL$H$HL$ HD$HL$HT$ EWD$ HDŽ$ H$ H$ H$ H$x H$H$ HL$HT$pHT$H$ H\$HD$ HD$( HD$0HL$8HT$@H$x H $H$ Ht$H|$pH|$HD$HL$ HT$( H$x H$H$ HL$HT$pHT$H$ H\$ HD$ HL$(HT$0H$ H $HD$HL$HT$H$ HD$ HD$(HL$0H|$( tuH$ H$X H$x H$H$ HD$HD$pHD$H$ HD$ H$ H$ H$X H$ H$ H EWD$ H$ H H$ H$H$ HD$H$` HD$D$ HD$ HL$(H$H H H$HD$ D HD$H$ H $HD$H$H HD$ HD$HL$ H$ H$ H$ H H$x H$H$ HD$HD$pHD$D$ HD$ HL$(H$P H H$HD$ HD$H$ H $HD$H$P HD$ HD$HL$ H$ H$ H$ H H$ H$H$ HD$H$` HD$D$ HD$ HL$(H$8 H H$HD$ HD$H$ H $HD$H$8 HD$H$ HD$ HD$ HL$(H$ H$ H$ H H$x H$H$ HD$HD$pHD$D$ @ HD$ HL$(H$@ H H$HD$ HD$H$ H $HD$H$@ HD$H$ HD$ @ HD$ HL$(H$ H$ H$ H H$ H$ H$ H L$ LT$xL$ L$h H$ H$ H$ H$ L$ H$ H$ L$ L$ H$ 1H$ 1H$ 1H$ 1H$` 1H$ 1H$h H$ H$ H$ LT$xL$ L$ L$h L$ L$ H$ H$ L$` H$ H$h H$ H$ H$ H$ L$ L$ Mt3L$ M$ MoM+oM}I$ MML$ H$ 1H$ H$ H$ HD$HL$ HT$H\$Ht$H|$LD$H|$ f H DJf @ Aݩ ALrerK H H9. IHIH$ Hu H$ H$ H$h H$ H<1H$X L$ I9r
L$h gH$ H$ H H$H$h HL$Ht$LD$H|$ HD$(HL$8H$ H$ IIH$ L$ L$h I1H$HT$HL$ H H$ H$ H$X H$h H$ L$ L$` mH AݩuH H9? f H A0͢g H H9I HNHH$ Hu H$ H$ H$` H$ H<1H$X L$ I9r
L$` dH$ H$ H H$H$` HL$Ht$LD$H|$ HD$(HL$8H$ H$ IIH$ L$ L$` I1H$HT$HL$ H H$ H$ H$X H$` H H$ HIH$ H$ IH$h H f) Ar H H9 H$ H$ HD$H$ = u(H$ HHA@A@A(@(*H
H $HD$H$ HL$ H$ H$ Hu1 H$ H$H$ H\$H$ Ht$H$ H|$HL$ EWD|$(HD$8 HD$@ D$HHL$PHT$XH|$P t
H$ tH$ @ HtcH$ H$H$ HT$H$ H\$HL$H$ Ht$ HD$(HL$0H|$( ' H$ H$ u/H$ H$ HD$HL$H|$ H$ H H$ H$ L$ H$ H$ L$` H$h H H H H$ H$ L$ H$ H$ L$` H$h LH H$ H$ L$ H$ H$ L$` H$h H\$xH H$ L IHMIPI@H9 H)IHH?H!IH$ L9U H$ fH9= I)H)LII?I!MȐHu-= u
Hdž H 1 1E11H$ H$ L$ H$ H D H` t1H$ H $H$ HT$HD$ HD$H
H H\$ H@xH $HL$HT$D$H$ H$ H\$xL$ H$ 1@uH$ H$ H$ H $H$ HL$HD$D$ HD$ HL$(H$0 H H$HD$ HD$H@H$0 H $H$` HL$H$ HT$H$ H\$HD$ HL$(H|$ H$ H$ H\$xL$ 111H H$P H$ H$ H4$H|$HD$ HD$(HL$HT$ H H` t1{H$` H$ H$ H $HT$HD$ D HD$H
H H\$ H@xH $HL$HT$D$H$ H$ H$` u H$P H$ H$ H $HT$HD$D$ HD$ HL$(H$( H H$HD$ HD$H@H$( H $H$` HL$H$ HT$H$ H\$HD$ HL$(H|$ fu111HH H$ H$ H$ H H4$H|$HD$H$` HD$H$ HD$ H$ HD$( HD$0HL$8H|$0 f D < H$ H Htkf D HC H$ H$h HD$H$ HD$ H$ H$H$ HD$H$ HD$ @ H$h H$H$ HD$H$ HD$ HD$= t.H
H
= u H H= H
H$ H$ H$ Ht Zރ HH@ HD111H$ H $H$ HL$H$ HL$HT$HD$ H|$( HD$xHH D Ht_H H$ H$ HD$H$ HD$ H$h H$H$ HD$HD$xHD$ @ H$h H$H$ HT$HL$ HD$HL$ H@HH $HD$HL$H H $H|$ H$ H$H$ HD$H$ HD$ HD$= t.H
H
= u H H= H
H$ H$ H$ HtQӃ HH HD111H$h H$H$ HT$HT$xHT$HL$HD$ Ht$(f EWD$ H$ H H$ H$ H$ H H$ H$ H$ H H$ H$ H$ H H$ H$ H$ H H$ H$ H$ H H$ H$ H$ H H H$ HD$H@ H
HH@ H
H $HD$ L HPH$X 1111E1E1E1E1E1E1E11H$ 1H$ 1H$ 1.H$ HH$ H$ H$ HH$X L$ L$ I9; H$ HPHpf D I9n H$ L$ L$ L$ L$ H$ IkXL HT8HH Htf D H Hu}L $H$x HD$H$ HL$HT$pHT$D$ @ Ld$(L|$0H\$8H$ H$ H$ L$ L$ L$ L$ H$ L$ H$ H$ L$ L$ Hc Ht
H$ , L $H$x HD$H$ HL$HT$pHT$D$ H$ H HT$(H\$0Ht$8HtHyH+yLGH IMxH$H H$ H$x H H$ HD$= uH$ H H$ H HH$x H$ H$H 1H$ H$ L$ L$ L$ L$ IHIHH$ L$ H$ H$ H$ H HuyL $H$x HD$H$ HL$HT$pHT$D$ LL$(Ll$0HL$8H$ H$ H$ L$ L$ L$ L$ H$ L$ H$ pHf H H$ HtL$ H$ 7L $H$x HD$H$ HL$HT$pHT$D$ L\$(HD$0Ht$8H$ H$ H$ L$ L$ L$ L$ L$ L$ HHH$ H$ L$ H$ ~HILLL$ L$ H\$pMIML$ H$x L$ IH$ xLH H0HH$p H$@ $( B$8 B $H HpH$8 HE1E1 E H HpL@f D H9m HkXLH$H$x HD$H$ HL$HT$pHT$D$ HD$(HL$0HT$8H$ H $HD$HL$HT$$( D$ $8 D$0$H D$@ HD$PHL$XH|$P H$ H$@ H$p H$X HqH9fsII9LPLX M9| MkXO$Ol8If D ItIBuHIDL$ L$0 L$ DL$oH$( L$$H$x HD$H$ HL$HT$pHT$D$ H$@ H$8 H$0 H$ Ht H|LD$(L$ LL$0L$ LT$8L$` fH9t1@H $H|$HD$ D$H$0 H$ L$ L$ L$` t^Ht0HT(Hu JH$( H9$0 t14H$H\$Ht$ D$L$ L$ L$` 1uD$o^H$ H$LD$LL$LT$$( D$ $8 D$0$H D$@ HD$PHL$XH|$P uE H$@ H$p H$X H$8 L$ AH$( H$ H$ H$ H$ H H$ H$ H$ H HH @ LL H H$ D HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH@ H
H $HD$ H H$ HD$H@ H
HH@ H
H $HD$ @ dL4% Ld$M;f H H$ H$ H$ HH H s
H$ s
H$ HH$ H D H H$ H$HD$HL$ HD$HL$ H@HH $HD$HL$H$HL$ HD$HL$HT$ H$ H $H$ Ht$H$ H|$HD$HL$ HT$( H$ H$ H$ H$HD$HL$ HD$HL$ HT$(HHHH$ HH$ H$ HL$8H\$`HT$XHH H D H HS H$ D H H$ H$ HL$HD$ HD$HL$ H$HL$ D HD$HD$pHL$HL$HHtgHu)8TRUE 8True 8true H 8FALSuxEtp8Falsuxetb8falsuzxetTrH$HL$H HT$HD$ H|$ HD$p80t 81ft(8Ft/HD$p8Tt8fu
111f 8tu1 1 H H$ HD$H@ H
HHL$HHH= u HL$pHHHxHL$p H
H HP = uHH( Hx( 1HH Hu+HD$XH$HD$`HD$HD$8HD$L$ H$ H$ H$ HĈ H$H\$Ht$D$ EWD$ H$ HĈ H$ H H$ H$ HL$HD$ HD$HL$ H$HL$ HD$HD$xHL$HL$PHT$XH$H\$`H\$Ht$8Ht$ HD$HL$ H@(H $HD$HL$xH $HL$PHL$HD$
HD$ HD$ HL$(HT$0H|$( u.HL$XH $HL$`HL$HL$8HL$HD$f H$ H$ H$ HĈ H$H\$Ht$HD$ EWD$ H$ HĈ H H _ H$ H H$ H$ HL$HD$ HD$HL$ H$HL$ D HD$HD$xHL$HL$PHT$XH$H\$`H\$Ht$8Ht$ HD$HL$ H@(H $HD$HL$xH $HL$PHL$HD$
HD$ HD$ HL$(HT$0H|$( u,HL$XH $HL$`HL$HL$8HL$HD$ H H$ H$ H$ HĈ H$H\$Ht$HD$ EWD$ H$ HĈ H$ fH H$ H$ HL$HD$ HD$HL$ H$HL$ D HD$HD$xHL$HL$PHT$XH$H\$`H\$Ht$8Ht$ HD$HL$ H@(H $HD$HL$xH $HL$PHL$HD$ HD$ HL$(H|$ u'HD$XH$HD$`HD$HD$8HD$ H$ H$ H$ HĈ H$H\$Ht$WD$ EWD$ H$ HĈ Hu\H$ Hu
11H= H$ H$ H$ H$H\$Ht$H|$HL$ HD$( @ H H$ H $H$ HL$HD$ HD$HL$ H H $HD$HL$H$ H HT$HD$ HD$HL$ HD$(HD$hHL$0HL$@H H$f H|$HD$@HG= u
HD$hH
HD$h H H$ H$ H$ HĈ H$ H$ HD$H$ HD$ HD$XH$HD$`HD$HD$8HD$ D EWD$ H$ HĈ dL4% Ld$M;f H H$ H$ H$ HsHt$xH$ L$ L$ 1 HLIH9W LSHKH9S HD$`L$ LkXL\$pO$L$ Ol8A r
OlH @ I9}
Ol0O|(MtrLM!M9it dL<$Ld$Ll$ D$H$ H$ Ht$xH$ L$ L$ L$ L\$pHD$`L1Īt LI1 HD$`Ht$xH$ L$ LH$ L$ IfOlHI9u}Ol O|LMAM9it1YL<$LD$Ll$ D$H$ H$ Ht$xH$ L$ L$ L\$pL$ HD$`tl LOD@OdHI9~qIHMl8I<8MAM9it1XH<$LD$Ll$ D$H$ H$ Ht$xL$ L$ L\$pL$ HD$`I1҄ @ v Ƅ$ EWD$ H$ Hİ Ll$hIMH$ L$ L\$pL$ HD$`H$ Ht$xL$ L$ H9jIHM|M$OL@K\HI9i I\ M L9Ll$hL$$LL$L|$ |$ WL$$H$ HD$H$ HD$H$ HD$D$ HD$(HL$0HT$8H$ H $HD$HL$HT$H$ HD$ HD$(HL$0Ƅ$ H$ H$ H$ Hİ KTPKD@IL$H9o HL$xHT$pH$ H$ H$ HD$HL$ HT$H\$Ht$H|$ D HtB=ݩuH H9f H =rD H H9uH$ H$ HD$= u(H$ HHA@A@A(@(2H$ H
H $HD$H$ HL$ H$ H$ H $H$ HT$H$ H\$H$ Ht$H$ H|$ L$ LD$(LL$xLL$0LT$pLT$8HD$@f HD$PHL$XT$HH|$P f D wH$ H$ HD$HL$H|$ P3H f@Ƅ$ EWD$ H$ Hİ Ƅ$ H$ H$ H$ Hİ Ƅ$ H$ H$ H$ Hİ Ƅ$ H$ H$ H$ Hİ LH dL4% I;f H0Hl$(Hl$(HD$8H$ HD$HL$ HT$H\$H|$ Ht͋B=ݩuH H9tNH =ru2H H9uHD$8H$ HD$HL$H|$ w H iEWD|$@Hl$(H0HD$@HL$HHl$(H0HD$@HL$HHl$(H0 dL4% L$M;f H H$ H$ H$ HtHHHH H$HL$H$ HL$ HD$HL$ |$( H H$ HD$H$ H@ H$ H H$ H $H|$uSH H$ H9
t 7H $H$ HT$HD$ D$H$
H$ 1t1H$ H H$ H$HD$H$ 1 HɐKH H9u%H$ EWD$ H$ H H$HT$H HD$ tHAHH
H $HD$H$ HD$H HD$H$ HL$ HD$(HL$0H H9u%H$ EWD$ H$ H H$HT$H HD$ H$ HH$ HfH9 H$ H$ HPPH$ H $HL$HD$H$( H$0 Ht$Hl$Hl$ Hm H$( H$ H$ H$0 Hl$Hl$ Hm H$ t$ u QH$` H$X H $HD$H HD$HD$ HD$ H|$(u8-1 @ t
H$ $ H$H HD$xH$P H$ H H $H|$tHD$xH$ f!HD$xH@HH$ H $HD$HL$H$ HD$xH H $H|$ H$ H$H$ HL$H$( HT$ HD$HL$ HT$(H|$ X H$( H$0 uE9XMLNu=fyamu5yeu/= uH$ HH$ HH$ H$H$ HL$H$ HT$ HD$ HL$(H|$ H$ SHD$xH$H$ HD$ HD$HL$HT$ H|$ H$ H? uH= uH HHH@H~H$ 1 H$ HHDŽ$ H$ H$( H$ H HDŽ$ H$ H$( H$ H HDŽ$ H$ H$( H$ H H$ HH$ HXHHH$ H$ HH$ HpH$ Hl$Hl$ Hm H
H $ HD$H$ HH$ HZH$ L$ Hw ^H$ L$ H
H $HD$HD$ HD$ H\$ D HD$(HL$8H$ L$ HH$ H$ HHH $LD$HHT$ H$ H$ H$ H$ H$ H$ H$ H$H$ HL$H$ HT$H$ H\$ HD$ HL$(H|$ u'H$ HH$ f D H9FHDŽ$ H$ H$( H$ H dL4% L$M;f Hx H$p H$p H H$ H|$H$ H$ HHHHPPHXXHWH_= u H @ HH0HP8H $HT$H
HL$HD$ HD$(HD$`HL$ H$ H $HD$H HT$HD$ HL$ H|gHT$` H9
HAH9
H$ HK0H)HJHHH?H!H$ Hȃ= uHK(H{(
HT$`H$ HT$pH$ H$HT$H
HL$HD$ HD$ HD$( HL$8HD$@HT$0Ht?H
HZH2L@II?IILIM L$ 1 H$ HC8 Ht$pH$ H{0 H H$ HH0HP8H $HT$H
HL$HD$ HD$ H$ HL$(HL$hH$ EWD:H$ EWD;H$ EWD;H$ H3H[H4$H\$ HD$H
H$ H$ H$ HtH@H$ H$ H$ H$ H$HD$hHD$ HD$H
H$ H$ H H$HD$6 H$ HD$HD$ HD$ HD$(HL$0HDŽ$ H$ H$ H$p Hx L$ MIxueA9XMLNu\fAyamuSAyeuLHs = uH{HCHH D H$ EWD$ H$p Hx H I@ IH(H$HL$ HD$HtTHH(HP0HXH@ H$ HV0= uHN( H~( HF = uH^CH~f 6H$ HH@H$ HB = uHJ Hz HH$ EWD$ H$p Hx HL$HHD$PH$ Ht$pH$ H<$Ht$H HD$HD$ HD$ HD$( H|$0HL$8HD$@H H u(H$ HHrHw= uH H$ HYHHLD H f D ML L$ MA = uIYMAIL Lf H IY8 x HL$H H HD$PHHHH?HH$ HH$HAHD$HT$H HD$HD$ HD$(H$ HL$0H$ H$ EWD:H$ EWD;H$ H $H\$pH\$ HD$H
H$ H$ H$ H$H$ HD$ HD$H
H$ H$ H H$HD$$ H$ HD$HD$ HD$ HD$(HL$0HDŽ$ H$ H$ H$p Hx IqHIAP= uIy@IA@HH IA8 HB HD$xHJ(H$ H$HL$ HD$H$ HtPHH HPH$ HsH9K t 9H$Ht$HL$ D$H$ H$
H$ 1Ʉu(IL$ EWD$ H$p Hx H$ EWHf f D Hl$Hl$ Hm HCHK H$HL$ HD$H
H$ H$( H$ HtH@H$0 H$ H$8 H$ HH@H $HD$ HD$H
H$@ H$H H$ HPH@ H$HD$ HD$H
H$P H$X HD$xHtH@H$` H$ H$h H H$HD$A H$ HD$HD$ HD$ HD$(HL$0HDŽ$ H$ H$ H$p Hx H$ EWD8H$ EWD9H
HRH $HT$ HD$H
H$ H$ H$ HtH@H$ H$ H$ H H$HD$( H$ HD$HD$ HD$ HD$(HL$0HDŽ$ H$ H$ H$p Hx ø 1 L$ MH8MIIAI'MuIMP8L$ It:}It2f D It&iI ItI tU @ I@tIBuEL$ MIzuA;XMLNufA{amuA{etHt @ It1
L$ 1MH8MII@uIMX8MH8As
I t@tHHLIB0IJ8H$HL$H HD$HD$ HD$ H$ HL$(HL$XH$ EWD:H$ EWD;H$ EWD;H$ H3H[H4$H\$ HD$H
H$ H$ H$ HtH@H$ H$ H$ H$ H$HD$XHD$ HD$H
H$ H$ H H$HD$+ H$ HD$HD$ HD$ HD$(HL$0HDŽ$ H$ H$ H$p Hx ILMM`IwIu!fA;an A{y IJ8@ IuA;attr IJ8 I A;cdat A{a IJ8 @ Iu2A;comm fA{enf D A{t| IJ8 uIu:IchardataM9#uIJ8YIinnerxmlfM9+uIJ8AIomitempt5I u%IomitemptM9#u A{yuMZ8IMZ8
IomitemptL_M9/1 H dL4% L$xM;f H H$ H$ H$ H$ $H$ H@HH$ H $HD$HL$H$ H$ H H $H|$tH$ H H$ H$H|$u+H$ H H$ H$HD$HD$x1-HDŽ$ H$ H H$ HJHD$xH9 H$ H$ HPPH$ H $HL$HD$H$ H$ Ht$f Hl$Hl$ Hm H$ H$ o8XMLNcfxam @ SxeIH$ H$H$ HD$H$ HD$ HD$H|$ u Hx tH$ H$ H HDŽ$ H$ H HD$HL$H9|HL$HD$dL4% L$M;f H H$ H$ H$ HZH$ L$ 1111HH$ H9 LJLRL9s LkXO\8IM`8IM9uH$ L$ H$ H$ L$ O\0Od(M Mh0Mx(Mt{M9tA uL$$L|$L\$ D D$H$ H$ H$ H$ H$ L$ L$ L$ AH$ E1E1EMXHOd
HM9MML$ E1
H$ H$ H$ H$ H$ H$ L$ O\
@Od
HMhHMx@f D M9 IOL OT MX D M9H NL$L\$LL$ |$ H$ HZL$ @ I9r
H$ JH H$H$ HL$HT$LD$H\$ Ht$(HD$0H|$8HXH$ IL$ L LH$ LHH$ L$ H$ H$ H$ H$ H$ H$ L$ P IO\<O$<Ol
OL
M9*L$$Ll$L\$ @ |$ H$ HZL$ I9r
H$ JH H$H$ HL$HT$LD$H\$ Ht$(HD$0H|$8HXH$ IL$ L LH$ LHH$ L$ iH$ H$ H$ H$ H$ H$ L$ ,MX M`Ol
OL
fM9L$$LL$L\$ |$ H$ HZL$ D I9r
H$ JH H$H$ HL$HT$LD$H\$ Ht$(HD$0H|$8HXH$ IL$ L LH$ LHH$ L$ MH$ H$ H$ L$ H$ H$ H$ HZH$ Ht 1 D ; A I H$X IpH$` Hl$Hl$ Hm HBHJLBLHM9siH H$HL$HD$LD$LL$ HD$(HL$0HT$8H$ HS= uHCH$ f HHHHHXHZHkXH= u1H$X HH<HH$` Hl$Hl$ Hm "H H$HT$H$X HD$ EWD$ H$ HĈ H H9}DL LRLZM9E MkXOLMPM9}EWD$ H$ HĈ 1HH9 L LRLZM9 MkXO\O$
OL
M9XuH$ HH`H$ H$Ld$L\$LL$HD$ H$ H$ Ht$(Hl$Hl$ Hm H$ H@`H$ HHYHIH$ H4$HT$H\$HL$HD$ H$ H$ Ht$(f D Hl$Hl$ Hm H$H H$P H$HL$H HD$HD$ HD$ H$ HL$(H$ H$ H$ H $HT$H HT$HD$ HD$ H$ HL$(H$ H H$ HD$H$ H= uH$ HHHxH$ H$ H$ HP= uHH
Hx @ H$ HH(= uH$ HH Hx H$ H$ H$ HP8= uHH0 Hx0 H$ HHH= uH$ HH@Hx@H$ H
H$ H$ H$ HĈ LI+HHL$ MJH$ HH$ L$ M JHJHzLRH9 IH)I)LkXMII?M!IHI9 L$ H H$LT$HL$IUHH?I\$XH!H HT$HHL$ f H$ HPHHH H9 4 A I H$ IpH$ Hl$Hl$ Hm HBHJLBLHM9sgH H$HL$HD$LD$LL$ HD$(HL$0HT$8H$ HS= uHC
H$ HHHHHXHZHkXH= u2H$ HH<HH$ Hl$Hl$ Hm #H H$HT$H$ HD$ EWD$ H$ HĈ L LL LL L$ M]L$ L$ L$ L$ H$ H$ H$ H$ H$ H$ M9YOl
@O|
HM9sgMIKT+O,+IX@M@HM9s=MI\H9L$ L,$LD$HT$ |$ 7LLf LL L fdL4% Ld$M;f H H$ H$ H|$8EWH @ Hl$Hl$ Hm H$ HHPHtHIHL$8HT$@HHHPH $HT$ HD$H
HL$HHD$PH$ HP HX(H$H\$ HD$H
HL$XHD$`H$ HP0HX8H$H\$ HD$H
HL$hHD$pH$ HP@H@HH$HD$ HD$H
HL$xH$ H H$HD$; HD$8HD$HD$ HD$ HD$(HL$0H$ H$ H$ HĐ Ð VdL4% Ld$M;fG H H$ H$ H$ HH$ H@HD$`1H$ H$ H$ =H<$H\$Ht$LD$ HD$PHPH|$ H\$(Ht$0HD$`H$ H9D HT$PLH~LD$8H|$hHt$@H\$pH<$H\$Ht$ HD$HD$HHL$ HL$xH H $H|$t14HD$HH@HHL$xH $HD$HL$H H $H|$a HD$@HH HD$XHwHPHv:Ht D Hv$HuHD$pH8 Ff D Ho s
HD$p fs
HD$pHHD$pHHf D $ HT$hH$HD$HL$ HD$HL$ H@HH $HD$HL$H$HL$ HD$HL$HT$ H\$hH $Ht$pHt$H|$@H|$HD$HL$ HT$( HD$pHL$@HT$hH$HD$HL$ H|$H\$ Ht$(Ht$@H|$hH\$pLD$8EWD$ HDŽ$ H$ HĐ H$ H$ H$ H$ HĐ H H$ HD$H@ H
HHL$XHHH
H $HD$ dL4% I;f H`Hl$XHl$XHD$hHHH $HD$
HD$HL$HT$hHHRH$ H5 Ht$HD$ HD$HL$ H HD$(HD$0 H\$8HT$@ HD$HHL$PHD$pHL$xHl$XH` D 6dL4% I;f HHHl$@Hl$@HDŽ$ H$ EWD8H$ EWD8H$ EWD8HD$xHD$0H
H $HD$HD$ @ HD$HD$8HL$pHT$xH H $HD$H\$0H\$HL$HT$ HD$8HD$pHD$0HD$xH$ HD$PH$ D$X$ D$h$ D$x$ Hl$@HHÐ HD$HL$HT$H\$ HD$@HL$HHT$PH\$XdL4% I;fvyH0Hl$(Hl$(HD$@H$HD$ D$ HD$HD$ H$HL$8HL$HL$@HL$ D HD$ HD$PHD$@HD$XHD$`Hl$(H0 ndL4% I;fvyH0Hl$(Hl$(HD$@H$HD$ D$ HD$HD$ H$HL$8HL$HL$@HL$ D HD$ HD$PHD$@HD$XHD$`Hl$(H0 ndL4% I;fvyH0Hl$(Hl$(HD$@H$HD$ D$ HD$HD$ H$HL$8HL$HL$@HL$ D HD$ HD$PHD$@HD$XHD$`Hl$(H0 ndL4% I;f H@Hl$8Hl$8HD$p HD$xEWD8H$ EWD8HD$`HD$ HL$XHL$(H$HD$ D$ HD$HD$0H$HL$(HL$HL$ HL$ HD$0HD$XHD$ HD$`HD$hHD$HHD$pD$PD$xD$`$ Hl$8H@ dL4% I;fvyH0Hl$(Hl$(HD$@H$HD$ D$ HD$HD$ H$HL$8HL$HL$@HL$ D HD$ HD$PHD$@HD$XHD$`Hl$(H0 ndL4% L$M;f H H$ H$ H$ f D H @=^ f =Lrer H$ H
f D H9u H$ HHHL$8H HD$XH $HD$ D$ HD$HD$xH$HL$XHL$HL$8HL$ @ HD$xH$HD$8HD$HD$ HD$H
H$ H$ H$ HĨ =^ H$ H
H9 H$ HHHL$0H HD$hH $HD$ D$ HD$HD$xH$HL$hHL$HL$0HL$ HD$xH$HD$0HD$HD$ HD$H
H$ H$ H$ HĨ f f=*ǒu H$ H
f D H9 H$ HH$ @$ @$ H$ H$ $ $ $ $ H$ HD$HH$ HL$pH$HD$ D$ HD$HD$xH$HL$pHL$HL$HHL$ HD$xH$ HD$HH$ H$ H$ H$ $ $ $ $ H H$H$ HD$ HD$HL$H$ H$ H$ HĨ f f=0͢ H$ H
f D H9U H$ HHHL$@H HD$`H $HD$ D$ HD$HD$xH$HL$`HL$HL$@HL$ @ HD$xH$HD$@HD$HD$ HD$H
H$ H$ H$ HĨ =r H$ H
H9 H$ HH$ @$ @$ @($ H$ H$0 $ $8 $ $H $ $X H$X HD$PH
H $HD$HD$ HD$HD$xH$P H$X H H $HD$H\$PH\$HL$HT$ HD$xH$P HD$PH$X H$` H$0 H$h $8 $p $H $ $X $ H H$H$h HD$ HD$HL$H$ H$ H$ HĨ H$ H$ H$ H$ H$ HĨ dL4% Ld$M;f H H$ H$ H$HD$8H
H $ HD$= uHL$8H H HL$8 HD$0Hǀ Hǀ H
H $H$ HL$H$ HT$f HD$ HL$H|$ t.HT$0HJ@= u HBH HzH D H$ H
H9u
H$ uHx |H" H H$ HD$HD$(H
H $HD$ HD$ HD$HD$@ H|$HEWHf @ Hl$Hl$ Hm HD$@HD$H HD$P H$ HD$XH$ HD$`HDŽ$ HDŽ$ = u0HD$@HL$(HHyHt$H D Hl$Hl$ Hm )H H$HD$(HD$HL$@HL$ HL$(H HT$0HB@= uHJH HzH H$ H$ HĠ f VdL4% I;f H Hl$Hl$HD$(H
H9uHD$0HD$8Hl$H H$HD$H
H $ HD$= uHL$H H HL$ HL$(HHP= u HL$0HHXHxXHL$0 Hǀ Hǀ HD$8Hl$H dL4% L$M;f H H$ H$ H$ H HtBH{u;H H
EWD$ H$ H$ H$ H H H Ht2Hǂ = u
Hǂ [H E1 JH$ HD$HL$HT$ H\$Ht$ H|$Hu Hr H$ HHÀ: f D H$ H\$HH$H\$Ht$ HD$HL$ |$( tDHT$HH$ H = uH$ H +H H$ H$ HD$HH$ HHH H DCAݩ f D Ard L L9T H H$H F$P F$` F($p H H$ H$p H$h H* H\$x1 D H H9 HNH^H~H6H$ H$ H$ H$ Hu>xmlnu
~s Hu*f>xmu#~lu HDŽ$ $ H
H$ HuHu;xmlnu
{s H H$ H$ H5 H4$HD$HL$H\$f HD$ HH@|$( tH$ H$ H$ 5H$ u"H$ HH0HP8H$ H$ H$ HH$H$ HD$ D |$ tlH$ H$ H$ H$ H$ H$ H$ H$ H H$H$ HD$ H\$Ht$ H$ H H EWD$ H$ H$ H$ H H H9
t12H$ H\$`H $HT$HD$ D$H\$`H$ t_H$ H HtKHyftBH H$ Ht$HF H HH$ H HFH EWD$ H$ H$ H$ H H$ H$ EWD$ H$ H ÐH$H H$P Hu;xmlnu
{s Hu*f;xmu#{lu HDŽ$P $ H H$H /Hu*H$X H$` u;xmlnu{s D H H$H H$P H5 H4$HD$HL$H\$ HD$ HH@|$( tH$P H$H H$ 5H$P u"H$ HZ0Hr8H$P H$H H$ H$ L H$p H\$x1HH9 H$h H$p f D H9< L @INM 1Md1fIuA;xmlnuA{stMtHD$XL$ IuFfA;xmu>A{lu7JD$ = u
H
J HLIH
LH$ LL$pH I 1I\1H= H<$HD$HL$H\$ HD$ HH@|$( t8HT$pH$ HD= uH
H$ H$ THT$pH$ HtHu5H$ LF0LN8LL= uLH$ f H$ HD$XHH\$xH$ L NH$H H$X H$P H$` L Mt9M= u L L ILM LL eHt$xH$ H\$pH$ H H$ D LL$H$ H$ H$ H\$pHt$xH$ L AL = uM ILM @ LL IA = fu L IYIq(= u
IAII Iy Iy H$H H$ $P $ $` $ $p $ L$H$ HD$ H\$Ht$f, H0LHD$pH$ $ F$( F $8 L$ H$ g A9xmlnY AysN H H$( H$0 H5 H4$HD$HL$H\$ HD$ HH@T$(H$( H$0 H$ L Mt-M= u L rL ILא LZT$6Ht$PH$ HD$@H$ H H$ LD$HD$@H$ T$6H$ Ht$PH$ A L = uMIL LI@ = uL H$ L$ IH$ Ip(= uIX Ip IH LI@= uIH I@H AP0I H$0 H$( H$8 H$ H$@ Ht$hH= H<$HD$HT$HL$ D H|$ HD$hHG= u
H$ H
H$ HD$pH$ H\$xH$ H$ L H$ + L$( H$0 A9xmln Ays H H
H $HD$EWD|$ HD$ HH@T$(H$ H Ht$L= u
L NH @T$7H$ HD$8H H$ Ht$HD$8H$ T$7H$ L = uLH HF = fuH H$ H$ D HF( = u HF fLF ILME1 LHF= uHN HFH V0H H$8 H$ H$@ HT$hH5 H4$HD$EWD|$ H|$ HD$hHG= u
H$ H
H$ HD$pH$ H\$xH$ H$ L LH L9P dL4% I;fd H8Hl$0Hl$0H|$HHHOHu8xmlnuxsu
Hl$0H8HuT$Pu
Hl$0H8HuGf8xmu;xlu0HG$ = u H HFH D 3HHHu$HGHu8xmlnuxsu
Hl$0H8HD$@H HH_H5 H4$HL$HT$H\$ HD$ HH@|$( t H|$HHG= uH7 0H|$HH u$HD$@HH0H@8HG= uH Hl$0H8 @ {dL4% Ld$M;f H H$ H$ H H$H$ HD$H$ HL$ HD$ HL$H|$ t.H$ HJ@= fu HBH HzH t H$ H
H9u
H$ uHx |H H H$ D HD$HD$(H
H $HD$ HD$ HD$HD$0 H|$8EWHHl$Hl$ Hm HD$0HD$8 HD$@ H$ HD$HH$ HD$PHD$xHDŽ$ = u+HD$0HL$(HHyHt$8Hl$Hl$ Hm )H H$HD$(HD$HL$0HL$ HL$(H H$ HB@= uHJH HzH H$ HĐ dL4% I;f HHl$Hl$HD$ H Ht#H= u H (H H H$ HL$HD$ H = uHH HT$(HQ= u H H HL$0Hl$H 0dL4% I;f HH,$H,$HD$H Ht_H= u H H HH HH = u HH H HH HH|$H,$H VdL4% I;f H Hl$Hl$HD$(H H Hy uHHHtHztH Ht#H= u H -H HL$H H$ HT$HL$HB H= uHHH H Hl$H %dL4% I;f HH,$H,$HD$H HttHumH= u H H HH HH = uHH f H HH D$H,$HD$ H,$H DdL4% I;f HHl$Hl$HD$ H Ht#H= u H (H H H$ HL$HD$ H = uHH HA = fu H H HD$0HAHD$@HA(= uHD$(HAHD$8HA HyHD$( Hy HD$8 Hl$H dL4% I;f HHl$Hl$HD$ H Ht#H= u H (H H H$ HL$HD$ H = uHH HA = fu H H HD$0HA(= u HD$(HA Hy HD$( HD$@HA= u HD$8HAHyHD$8 D$HA0Hl$H dL4% I;fvtHHl$Hl$H H$ H|$HD$0HG= u
HD$(H
HD$( HD$ H HGH HD$8H|$@Hl$H sdL4% L$0M;f HP H$H H$H H$X H H HtaH= u H HH HH = fuHH H H HH HHH$` HZHrLLJ H LW(L_ fI9 H$ H$ L$ H$ H$ L$ L $H\$LT$ |$ * H$ HHHPH$ H9uAH$H$ HD$HL$ |$ tH$X f H$ H$ H$ EWHl$Hl$ Hm H
H$ HDŽ$ HH(HP H$ H$ H
H$ HDŽ$ HPH@H$ H$ H H$ HDŽ$ H$ H$ H$ H$ H$( HDŽ$0 H$ H$8 H$@ H$ H$ HD$HD$ HD$ HD$ H$ HL$(HL$hH H$ H|$HD$hHG= u
H$ H
H$ H$X H HOH
H = u H H HH Ƅ$h H$H HP H$X H$` H$ H$ H$ 8 ƀ H
HZHrLBL H = uH H %H IH @ H LHGHO H_(HwHrHZ= u HHJH Hz Ƅ$h H$H HP HG HO(H$ H HT$HD$ HD$HL$ H HD$(HD$0 H\$8Ht$@H HD$HHD$P HD$XH$ HL$`HL$xH H$ H|$HD$xHG= u
H$ H
H$ H$X H HOH
H = u H H HH Ƅ$h H$H HP H$ H HD$HD$ H\$Ht$ H HD$(HD$0 HD$8H$ HL$@HL$pH H$ H|$HD$pHG= u
H$ H
H$ H$X H HOH
H = u H H HH @ Ƅ$h H$H HP H$X H HI HO H5 H+ H= fuH HH$ HH$ H = u H
H HH H H H߀z0 H HZ(Hr HzH$ HRH$ L L$HL$Ht$H\$ H|$ H$ HG= uH$ HH$ H HZ HR(H5 H4$HL$H\$HT$ Ƅ$h H$H HP D dL4% I;fX HpHl$hHl$hHD$xH HtLHy uEHA HI(H$HL$ HD$xHHHPH\$Ht$H~2HL$0H\$8Ht$ 1MEWD$ Ƅ$ Hl$hHpEWD$ Ƅ$ Hl$hHpH\$@HHHH|$(HT$@HHJH$HL$ HD$HL$HT$ H9u$H $HL$8HL$HD$ |$ u HT$ HD$(HHL$0H9dEWD|$HEWD|$XH$ H
@ H9uH$ HHXHpH@ HT$HH\$PHt$XHD$`u@HT$ H9t 'H4$HL$8HL$HD$ D$H
EWD|$HEWD|$XHD$xH HPHXHp H@(HT$HH\$PHt$XHD$`H $HD$HHD$ HD$HL$H$ H$ Ƅ$ Hl$hHp dL4% I;f H0Hl$(Hl$(HD$8H ~,H H
EWD|$@HD$PHL$XHl$(H0H$ HD$HL$HT$H\$ HD$@HT$HHL$PH\$XHl$(H0 @ [dL4% L$M;f$ H H$ H$ H$ HHPHPXH
H H HC
H$ D$|$ ) <<; H$ H$ D$|$ <! </k <?6 <
uH$ H H$ H H H $ HD$HL$HT$H\$ |$( t0H$H H$ H$@ H$ 11L H$ H uiH H$ HD$H@ H
HH$ H HPH H = u H H HH H EWD$ H$ H$ H$ HĐ H$ H$ HD$HL$|$ tUHL$PH$ H$ H$ H$ H@h H@x ƀ HH`H$ 1 D H$ H uiH H$ HD$H@ H
HH$ H HPH H = u H H HH H EWD$ H$ H$ H$ HĐ H$ H$ HD$HL$HT$ H\$|$( H$ H ukH H$ HD$H@ H
HH$ H HPH H = u H H f HH H EWD$ H$ H$ H$ HĐ H$H H$ H$@ H$ H$ H$ H$ H$ D$|$ <>) H$ H HD$HD$ H$H HD$H$ HD$ H HD$(HD$0 HD$8H$ HL$@HL$XH H$ H|$HD$XHG= u
H$ H
H$ H$ H HOH
H = u H H HH H H EWD$ H$ H$ H$ HĐ EWD$ EWD$ H$@ H$ H$ H$ H$H H$ H$ H$ H H$H$ HD$ HD$HL$H$ H$ EWD$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H$ D$|$ <-tR @ <[u1
H$ HAh HAx Ɓ HQ`H$ H$D$f 11 H$ H$ D$|$ <-u4H$ H@h H@x ƀ HH`H$ 11 H H$ HD$H@% H
HH$ H HPH H = u
H H H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ Ð<
uH$ H H$ H H H $HD$D$ HD$HL$ HT$(HtLH$HL$HT$ HD$H
H$ H$ EWD$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ ƀ EWD$ EWD$ H H H H H$ H$ H$ H$ H H$H$ HD$ HD$HL$H$ H$ EWD$ H$ HĐ EWD$ H$ H$ H$ HĐ HAH$HD$HL$HT$H\$ H$ H$ H$ H$ H$ HĐ H$ \$N\$KT$OH$ D$|$ r D$NH$ H$ D$O<-u
\$K-u\$K\$N> H$ HKhHs`HSpHCxH9[ H)HH)HHH?H!HH90 H$HL$H\$ HD$H
H$ H$ EWD$ H$ HĐ H H$ HD$H@- H
HH$ H HPH H = u H H H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H HH$ D$JH$ H$ D$|$ T$Ju$<>uH$ H= iH$ . H$ ! H$ H$ HZ D tH$ eH$ @ T1H$ EH$ HJhHZ`HrpHBxH9U H)HHH?H!HH $H)HL$HT$ HD$H
H$ H$ EWD$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ HYD$NH$ H$ H $D$ D$NL$J8 <'<" <><<u1D$N1! HCL$JH}}HD$pH$ H$ D$|$ tH\$pH5 < @8tH$ H H EWD$ H$ H$ H$ HĐ H$ HXhH+Xx D Hu H@h H@x ƀ fAƀ HsH HPpHxhL@xL)H9 J H[H9 HXh11 ʉH$ \$LT$OH$ D$|$ tIL$O-uL$L-u<>uL$LH$ H$D$ L$JH$ ~H$ H H EWD$ H$ H$ H$ HĐ H H H$H HD$ HL$`1H$ H$D$f HD$`HHD$NH\$pH5 H9|P HAH' HD$hH$ H$ D$|$ HL$hH
8tH H$ HD$H@ H
HH$ H HPH H = u H H D H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H$HD$D$f HD$HL$ HT$(HtLH$HL$HT$ HD$H
H$ H$ EWD$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ ڈT$MH$ D$|$ D$NH$ H$ D$M<?u \$N>u\$N릐H$ HKhHs`HSpHCx D H9 H)HH)HHH?H!HH9 HT$PH H$ f>xmy ~lo H$ H$ H$ H$ HD$HL$ HD$H$ HL$ H$ H H$HD$ HD$HL$ HD$(HL$ H Huf91.u
y0 EWD$P H $HD$ HD$H
H$P H$X H H$HD$: H$P HD$HD$ HD$ HD$0HL$(H$ H = fu H H H H EWD$ H$ H$ H$ HĐ H H$HD$ H$ HD$H$ HD$ HD$ H$ HL$(HL$x @ HtsHu)8utf-tH x8tUHu8UTF-ux8t<H$HL$H HT$HD$ D$ HL$xH$ 1 11f D H$ Hz( HB@HJHH$H H H $HD$ D H$ HP(H
H$ H $Ht$xHt$H$H H|$HD$0HL$8HT$ H\$(Ht$(H|$ H|$0 4 Hc H$H H$ H$ H H$HT$Ht$ HD$ HL$H|$ t.H$ HJ@= u HBH HzH f H$H H
H9u
H$ uHy N H H$ HD$H$ H
H $HD$ HD$ HD$HDŽ$0 H$8 EWH Hl$Hl$ Hm H$0 HDŽ$8 HDŽ$@ H$H H$H H$ H$P HDŽ$x HDŽ$ = uAH$0 H$ HHyH$8 f @ Hl$Hl$ Hm 2H H$H$ HD$H$0 HL$ H$ H H$ HB@= u HJH, HzH H$ H$8 H$` EWD8H$p EWD9H$ H $HL$xHL$ HD$H
H$` H$h H$8 HtH@H$p H$ H$x H H$HD$ H$` HD$HD$ HD$ HD$0HL$(H$ H = u H H H H EWD$ H$ H$ H$ HĐ EWD$P H$HL$ HD$H
H$P H$X H H$HD$: H$P HD$HD$ HD$ HD$0HL$(H$ H = u H H H H EWD$ H$ H$ H$ HĐ H$ H$ HT$PH$ H$ H$ HDŽ$ H$ EWD;H$ EWD;H$ H$ H$ H$ H$ H H$H$ HD$ HD$HL$H$ H$ EWD$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H HD$HD$0 H$ HD$HD$xHD$ HD$(HL$0H$HL$f HD$H
H $HD$ H HHL$( H$ H$ H$ H$ H$ H$ D$|$ 1 @ </ <> <
uH$ H H$ H H H$ EWD8H$ EWD:H$ EWD:H $ HD$HL$HT$H\$ |$( H$ H$ H$ H$ ( H$ H$ H$ H$ D$|$ <=tQH$ 9 @ <
uH H H H$ H$ H$ H$ ]H$ H$ H$ H$ H|$ H$ HD$HL$ H$ H$ H$ H$ HPH$ H9r
L$( RH
H $H$( Ht$HD$H\$HT$ LD$(HD$0H|$8HPH$ H$ HH@HI4 = u/$ I H@$ $ @[L$0 H$ H$ H H$Ht$H$ HD$ H$ H$ H$ L$0 H H$ D HD$H@# H
HH$ H HPH H = u H H H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H uiH H$ HD$H@" H
HH$ H HPH H = u H H HH H EWD$ H$ H$ H$ HĐ H$ H$ H$H H$@ H$ H$ D$|$ <>a H$ ƀ H$ H H$ H = u H$H H H$@ H +H H$H H H$@ HHDŽ$ H$ EWD8H$ EWD8H$ EWD8H$ H$ H$ H$ H$( H$ H$ H$ H$ H$( H H$H$ HD$ HD$HL$H$ H$ EWD$ H$ HĐ H H$ HD$H@ H
HH$ H HPH H = u H H H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ H$ H H EWD$ H$ H$ H$ HĐ FdL4% I;fF H@Hl$8Hl$8HD$HH$ D$|$ <" <' HL$H9 u?<
uH H H HAh HAx Ɓ HA`HD$0 H H$ HD$H@. H
HHL$HH HPH H = u H H EWD|$PHD$` Hl$8H@HL$HH $HD$D$ HD$HL$ HT$(HD$PHL$XHT$`Hl$8H@EWD|$PHD$` Hl$8H@HD$0H$ HL$HH $ D$|$ PvȍPvPЀ vf<_t<:t<-t<
uHT$HH HT$HH H HJhHZ`HrpHBxH9rLH)HHH?H!HH\$PH)HL$XHT$`Hl$8H@EWD|$PHD$` Hl$8H@ fdL4% I;fvsHHl$Hl$HD$ H$ D$|$ tAHvސ<
t< tՐ<
uHL$ H HL$ H H Hl$HHl$H tdL4% I;f H0Hl$(Hl$(HD$8H H D H|Hǀ HH@HPHHIH$HD$L$HT$H\$8H = u H H D H uLH HtL$'H$ L$'H\$8H
uH H L$@D$AHl$(H0D$@ D$A Hl$(H0D$@ D$A Hl$(H0 HD$H HD$HD$H HQH+QH HJHHMHT$dL4% I;f H0Hl$(Hl$(HD$8H$ D$ L$ HT$8H H H= H9 L$'D$&H $Ht$H|$ |$ u D$&L$'rH H$ HD$H@ H
HHL$8H HPH H = u H H D D$&L$'L$@D$AHl$(H0 D$<
uHL$H HL$H H dL4% L$M;f Hx H$p H$p H$ H@h H@x ƀ HH`H$X 11 ډH$ \$>T$?H$ D D$|$ \$?]u\$>]u<>u
\$><<u$ @u
$ H$ H| @8 <& @ H$ HHhH+HxHL$PH$X H$D$& H$ H$ D$|$ <# <
uH$ H H$ H H H $ |$ t
H$ H$ H , H$ D$|$ <;t8<
uH$ H H$ H H 111f H$ HJhHZ`HrpHBx H9 H|$PLGH)H)IHH?H!HL9 HL$HL$ H$ L$ H$X H$D$; H$ HL$PH)HHHH?H$ H!H$ HH$8 H$H\$HH)HH\$pH\$HT$f |$ uH$ 111 H$ H$H$8 HD$HD$pHD$ H HL$ HL$`HT$H$0 H H $HD$HT$HL$ HD$ Hc |$( u`H$ Hs Hu111qH H$Ht$H$0 HL$HL$`HL$ HD$ HH@T$(H$ *HL$DH $HD$ HL$HD$H$ H$X HƉHH H$X H$ H$ H$ D$|$ <xt
8H$X H$ H$ H$ D$|$ H$ H$ HshH+sxHt$XH$X \ D$=<
t?f
u<
H$X H$ D$=\$>$ H$ fH$X H$D$
D$=\$>$ H$ 1$ tH$ G H H$ D HD$H@" H
HH$ H HPH H = u H H EWD$ HDŽ$ H$p Hx H$ H}"H$ Hǃ < H 1 H H$f HD$H@ H
HH$ H HPH H = u H H EWD$ HDŽ$ H$p Hx H$ 1 EWD$ HDŽ$ H$p Hx EWD$ HDŽ$ H$p Hx EWD$ HDŽ$ H$p Hx EWD$ HDŽ$ H$p Hx EWD$ HDŽ$ H$p Hx $ ulH$ 1HKhHs`HSpH{xH9< H)H)H)HHH?H!HH9 H$ H$ H$ HHI H$ H H H f H9
H $HT$H\$ D |$ tfH H$ HD$H@ H
HH$ H HPH H = u H H EWD$ HDŽ$ H$p Hx H$ H$ L$ HHHH$ H H$ H$P H$ H4$HL$HD$ D$HL$ = u
H H$ f D H9q H$ H)H)HHH?H!H$P Hك C
2
)Xf f H H$ HD$H@
H
HH$ H HPH H = u H H EWD$ HDŽ$ H$p Hx EWD$` $ HD$H
H$` H$h H H$HD$ H$` HD$HD$ HD$ HD$(H$H HL$0HL$xH H$ H|$HD$xHG= u
H$H H
H$H H$ H HOH
H = u H H HH EWD$ HDŽ$ H$p Hx L$ H$ H$ H$p Hx HH H H H$X H$ H$ Ht$XD@A v* @ HuPD@AvHu@D@f D Aw0H<$D$ H$ H$ D$|$ u <;t$<
uH H H 111" HShLC`LKpHCxH9 H)I)MII?L!IH9 H$ HL)H?H!I 0HL$H)HT$ @ HD$H$( HL$ HL$hH$X H$D$; H$( H$HD$hHD$H$ HD$HD$@ f HD$ H|$( uH= v111(HL$@H $HcHD$ HD$HL$H¸ H$ H$X f D ; u$ H$ 11}HKhHS`HspHCxH9 H)H)HHH?H!HHD$Pf D H9 H$ H $HH)H?H!HHD$H)HL$ HL$ HAHT$H9G D<;t8H$ HT$HL$H HD$HD$ f HT$(HL$0H$ H HD$HD$ HT$HL$ HD$(H$@ HL$0H$ H H$ H|$H$ HG= u
H$@ H
H$@ H$ H HOH
H = u H H HH EWD$ HDŽ$ H$p Hx HD$PHuHCh HCx ƃ 5ƃ HspLChLKxM)L9 LH9 HChH$ H$HT$HL$ HD$HL$ HT$(H$X H $HD$HL$HT$ $ H$ 11 EWD$ HDŽ$ H$p Hx HH H H$H HD$ HH H L D D$ t#
t
tH v w = |
= 1D$dL4% I;fJ H@Hl$8Hl$8HD$HH$ D$HL$HT$f HT$0HL$(H$HL$H HD$HD$ H|$ ~1H\$(HT$01 HD$0H$HL$(HL$H HT$HD$ HD$ H}HL$(HL$(HQH9~H11HT$0$HPH9r`H)HHHH?H!Ht$0HHt$PHD$XHT$`H\$hD$pHl$8H@EWD|$PEWD|$`D$pHl$8H@H dL4% I;f H`Hl$XHl$XHD$hH@h H@x ƀ H$ |$ HT$hHJhHZ`HrpHBxH9 H)HHH?H!HH\$HH $H)HL$8HL$HT$f |$ H$ H HD$HD$ HD$HHD$HD$8HD$ HD$(HD$PHL$0HL$@H H$ H|$HD$@HG= u
HD$PH
HD$P HD$hH HOH
H = u H H HH EWD|$pƄ$ Hl$XH`H$ HD$HHD$HD$8HD$ HD$HL$ HD$pHL$xƄ$ Hl$XH`EWD|$pƄ$ Hl$XH` @ dL4% I;fe H0Hl$(Hl$(HD$8H$ D$L$ <s^HvVHvNHА vE<_tA<:t=<.t9<-t5<
uHL$8H HL$8H H D$@ Hl$(H0HD$8 HH`HL$ H $f L$@Hl$(H0HD$ H$f HD$8H$ D$L$ tf<s͍HvōHvH D v<_t<:t<.t<-t<
uHL$8H HL$8H H D$@Hl$(H0ÈL$@Hl$(H0 {D$Hv HvHЀ v <_t<:t<.u <-D$dL4% I;f HXHl$PHl$PHD$hH HL$`H $HD$HT$pHT$ D$HL$ HL$0f D = uHuD$x Hl$PHXH
H $D$ |$ tHT$`H\$pHt$hHL$03D$x Hl$PHXD$x Hl$PHXHT$HH\$@Ht$8HL$0H9 H)H\$@HHH?H!HHT$HH$H)Ht$8Ht$HD$ D$HL$ HL$0= u
@ HtLD$,H
H $D$ |$ bH H$D$,D$ @ |$ ;D$x Hl$PHXD$x Hl$PHXD$xHl$PHXHH +dL4% I;f HHHl$@Hl$@HD$XHtxHL$PH $HD$ D$HL$HL$(= uHuD$` Hl$@HHH
H $D$ |$ tHT$PH\$XHL$(-D$` Hl$@HHD$` Hl$@HHHT$8H\$0HL$(H9 H)H\$0HHH?H!HHL$8H $HD$ D$HL$HL$(= uHtHD$$H
H $D$ |$ yH H$D$$D$ |$ VD$` Hl$@HHD$` Hl$@HHD$`Hl$@HHHH @ [dL4% I;fvjHHHl$@Hl$@HD$PH$HD$XHD$HD$`HD$HD$hHD$HD$pHD$ D$( HD$0HL$8HD$xH$ Hl$@HH f{dL4% I;f# HpHl$hHl$hH$ H$ H$ 11$H$ H$ L$ LHHHH9F HD$@HL$8H)HHH?H!HH4$H)HT$H|$ D$HL$ HT$@H
f "
a t:
$ @u
HD$8LH= L L
H= L L
$ s
t+" H= L L
$ C H= L L
$ @ 'V&t''uZH= L L
$ H= L L
$ < >tx tB
t=
t8p v v @ w = uHt$ HD$8H= L L
$ <H= L L
$ H= L L
$ HD$8H9u H\$XLL$PLD$HH|$`HL$xHYH$ H4$H$ H)IHH?H!L$ LH|$H)HT$LL$HD$(HL$0H|$( uvHD$xHHH$ H$H\$`H\$H\$HH\$H\$PH\$HD$(HL$0H|$( uH\$X$ HH$ H$ Hl$hHpH$ H$ Hl$hHpH9r`HD$xH@H$ H<$H)HHH?H!HH\$H)HT$H|$HD$(HL$0H$ H$ Hl$hHpHH H H D dL4% I;f HpHl$hHl$hH$ H$ 11H$ H$ HHHH9] HD$@HL$8H)HHH?H!HH$Ht$ D$HL$HT$@H
@ "
B t#
H5 H= L L H5 H= L 2
t#" H5 H= L
H5 H= L 'I&t# @ 'uIH5 H= L H5 H= L < >th tB
t=
t8p v v @ w= uHt
HD$8XH5 H= L ,H5 H= L H5 H= L HD$8H9 LD$PH\$XHt$`H|$HHL$xHH $H)HHH?H!H$ HHD$H\$ HD$xHH $HL$`HL$HL$HHL$HL$PHL$ H\$XHH9r8HD$xH H$H)HHH?H!HHL$HD$ Hl$hHpHH H H dL4% I;fvSHHHl$@Hl$@HD$PH$HD$XHD$HD$`HD$HD$hHD$HD$pHD$ D$( Hl$@HH dL4% I;f H`Hl$XHl$XH$ Ht{H H
H H\$hHsH|$pH<$HD$HL$HT$HD$(HL$0H|$( uH$ H$ HT$xVH$ H$ Hl$XH`EWD$ Hl$XH`H\$HH)H)HHH?H!H\$PHHHD$HHL$@HT$PH H5 H= H$HL$HD$H\$Ht$ H|$( HL$0H H HH\$@H9 HT$HH9 HL$8HD$hHXHt$pH4$H|$PH|$HL$HT$HD$(HL$0H|$( @ H H
H H\$hHsH|$pH<$HD$HL$HT$HD$(HL$0H|$( u#H H\$8HHL$@H9 H$ H$ Hl$XH`H$ H$ Hl$XH`H\$@HD$hHHHT$pH$Ht$PHt$H\$H\$HH\$HD$(HL$0H|$( tH$ H$ Hl$XH`H H
H H\$hH[Ht$pH4$HD$HL$HT$HD$(HL$0H$ H$ Hl$XH` dL4% I;f HpHl$hHl$hHD$@H$HD$xHD$H$ HD$H HD$HD$ HD$0HD$8HL$(H$ H$H$ H\$HL$HD$ HD$ f H# HT$8HH$ f D H9* H)HHH?H!H$ H H <'t<"tEWD$ Hl$hHpHT$8H\$`HJHHH?HHH $Ht$D$ HD$HtOHHHT$8 H9 HruHHH?HHT$`HH$ H$ Hl$hHpEWD$ Hl$hHpEWD$ Hl$hHpEWD$ Hl$hHpø fdL4% L$XM;f H( H$ H$ H H$ HDŽ$ H$ Ht H
11HIHH$HD$HL$H
= u H H= D H H$ HDŽ$ H$ Ht H
11HIHH$HD$HL$H
= u H H= H H$ HDŽ$ H$ Ht H
11HIHH$HD$HL$H
= u H H= @ H$ EWD8H$ EWD9H$ EWD9H
H $HD$ HD$HL$H$ H$ H$ Ht H
11H
= u H H= f H HD$`HD$h HD$`Ht H
11HIHH$HD$HL$H
= u H H= H H$ HDŽ$ H$ Ht H
11HIHH$HD$HL$H
= u H H= H HD$PHD$X HD$PHt
H
11HIHH$HD$HL$H
= u H H= EWD$ EWD$ H H$H$ HD$ HD$HL$HD$pHL$xHD$pHt H
11H
= u H H= H H$ HD$H@1 H
HH
H
= u H H= H$HD$HH
H $HD$H HT$HD$ HD$ < H H$HL$HHL$H HT$HD$ HD$ > H H$HL$HHL$H HT$HD$ HD$ & H H$HL$HHL$H HT$HD$ HD$ ' H H$HD$HHD$H
HL$HD$ HD$ " = uHD$HH H= HD$H H H$HD$ HD$ HD$HD$@1HT$0HJHD$@H HL$0HH H4 Ht$8H= LLLHL HL$(L L$HD$LD$LL$ H|$ HD$(HG= fu
HD$8HmHD$8 ^= uH H H= f H= H$ H( U<!---->?>--"'&<>	

�<![CDATA[]]>]]]]><![CDATA[>
encoding/xml.fElement encoding/xml.fAttr encoding/xml.fCDATA encoding/xml.fCharData encoding/xml.fInnerXML encoding/xml.fComment encoding/xml.fAny encoding/xml.fOmitEmpty encoding/xml.fMode encoding/xml.stkStart encoding/xml.stkNs encoding/xml.stkEOF
: : A Z _ _ a z 1 4> AH J~ P O Q\ ^ 1V YY a !: AJ q 9 = = X a
(
*
0
2
3
5
6
8
9
Y
\
^
^
r
t
# ( * 0 2 3 6 9 = = \ ] _ a ( * 3 5 9 ` a
(
*
9
`
a
. 00 23 @E @G Ii <@ LP TU YY _a ci mn rs u) E H M P W Y [ ] ] _ } &!&! *!+! .!.! !! 00 !0)0 A00 00 1,1 N p p - . 0 9 E `a @| KR `i pp < < > L M M Q T b c f o
<
: >
?
@
B
G
H
K
M
f
o
p
q
< < > C G H K M V W f o > D F H J M U V f o
>
C
F
H
J
M
W
W
f
o
11 4: FF GN PY ) 59 >? q 0$*0/0 1050 00 00 00 y&6 j @ n'=6 0 ( O\ @ @ ۖ 6 0͢ 3 no 6 Lrer 6 [N yb6 r 8 ( p ` 6 Sf6 ݩ ( 8 ( r @ @ 1 6 (:6 7 WMq6 R0 X H z 0 P p k 6 [1{ @ )vH6 t 6 ! 2y @ P ` 0 @ P ^>~ 6 ^ %7d5 6 X:6 : >lo 6 x
0 0 P p x c ( 2a6 B- RA 6 ( *ǒ @ / 6 @ 2 6 P H @ ` P J 6 FE \W6 " 6 I ( Rƿy 6 ga @ 8 ( 8 ( 8 ( 8 ( @ @ 8 ( 0 ( ( 8 H X H 0h P ` 0 0 P P h P P P 0( 8 ( @ 8 ( 8 ( x ( p8 (
0 @ P ` p 0 ( 8 H
Q * I ; T * \ \ 6 ^ P^ h O T PT e PRe p P 6 ^ P^ h % U 6 ^ P^ h 6 ^ P^ h 6 ^ P^ h
͜U}UArU7AB_CU7|U7A66.F[UBA@ i[A f=2A7 hA #
encoding/xml.Marshal v O ~r1 O ~r2 O &b P
~R0 err Q Q T X H
; I < - * ] < * Q T * - . Q T ] f p p p ( 6 _ P_ p h % U P PR P 6 _ P_ p h % U 6 _ P_ p h 6 _ P_ p h % U p p ( 6 _ P_ p h
͜U }UArU7AB_CU7|U7A66.dm) U{32_z32m-7BA@ [A [ 2_S7 _
encoding/xml.MarshalIndent v } prefix } indent } ~r3 } ~r4 } &b ~ enc
~R0 err 8 & I O ! & - L O ! & - L T X 7 U X X @ v R
|=Z-#|o2}=UArU7AB_A7|oA}A66.`-Ap
~r1 (
AAf
( X &
+
k 3 ! & ) z > > P PR R > > ` P Q P P
l=F U$AKU{sk=A F7z=- Fi)3.#P#lGA@K$AA
encoding/xml.(*Encoder).Encode enc v ~r1 err ` X &
+
k 3 ! & ) z S S P PR % R S S ` P Q P P
l=F U$AKU{sk=A F7z=- Fi)3.#P#lG A@K$_A
encoding/xml.(*Encoder).EncodeElement enc v start ~r2 err ( P L 9 9 l u } @ , i q P PR P PR Q QS / RQS R
~Q
P~~ ~~ @ U ^ R^ f
~Qf ~
P~~~ i ~~ R
~Q
P~~ ~~ S ST STU P PR S m u Su } ST} STU W ^ P^ e PRe PRQ P PR
_$___$U~77AP$U_A_j__n_zQAr!__$7sA_j__Xe#FU_A\__DAZ|=$U_A7iAU~7APN_j_`i$__!__eFU_AU_Aj__7BA@_}d__~UAz=A__7BA@d_zQAV_+U_AS
encoding/xml.(*Encoder).EncodeToken enc t ~r1 t err err t t t t t @
? o ! P Y c f \ `
T u ? B v ! ) , / B E Y \ 1 4 < @ ; B hB R T hT x Rx h ; B ^B Q T ^T Q ^ ; B _B X T _T a X _ B P T `T P ` c } YJ v Y9 T Y [ Z ZS Z SZ v Y PY Y
A;)-{ep=Fh)M7LU0~-xFg=xgGE~=(K,>1-=1,F#$-z312E7v[12v3B7LU }7sAFs Fk==xzs FFk==x{Gp)12A(7$-&j)12j=14FAx-Axow}z
encoding/xml.isValidDirective dir ~r1 depth inquote incomment i c n S
A encoding/xml.(*Encoder).Flush enc ~r0 ( Y 4 i s X 6 f H / } x % 2 f s x O Y ] n x Px R ` h > h> s Rs ` , P, ` h Q QS * Q* Q SQ { h{ ` s v Rv PR R P H h * Q* Q SQ { h % R% ` { ` b g Pg l PRl PRQ R
_1_ }[_VAv) BA__KEA7UAt7 sA@}x}37UAP(|(s7,$_CsA%_nzok U|_+AT_C__`_j_# FA t=_k_-_q_8}37}FA(A} s=m
encoding/xml.(*printer).createAttrPrefix p url ~r1 prefix prefix i id 8
͜AOAp
H
͜Aq
H
5 + 6
0 e RXe `X T
RT
0 e RXe `X T
RT
͜ABxu7DAA7j-8-P{o
@ 6 \ i E X % + 3 I Q i 3 [ ` , E M [ c , o Z j T \ d l ( 3 { Z j T q ( 3 " * 2 R Z L q ( ` j { / 8 j { 8 F
' 6 g k z # g Z b b j b j E STR [ ST[ }~ ST E E ( P ~ P ; ~ ` e Pe PR
}~ QR R RS
}~ RS ;
}~ ; ; D }D R } # R PD # } ? D P P PR ` QSTU` QTU P PR R3 < R r T } T Y U
UX UXY : UXYP ? D PD T PRT \ R P PR R R RQ T TU TUX P PS S S j o Po PR R STR [ ST[ }~ ST STR [ ST[ }~ ST R R STR [ ST[ }~ ST STR [ ST[ }~ ST M P P
PR
A ~ STR [ ST[ }~ ST n s Ps PR ~ P PR ~ STR [ ST[ }~ ST J O PO l PRl E ~ E TE ~ T T E UE } U E T TU TUX E P PR
-_U_A_w)N_!} d}[t77 7s=vddu-7K7 ~o (7 v3#P ~3# F v3 ( v3 (7x=( v3 P7O7$-/--x)`77sF Fx_yeFxQ#~[_ <(xQB_CAx-NxG(x$3y~[ d <#|[{[L_BAx-NxG#K|[^_ | d[#(\=j_A7AABBAJ-J``d[ N-7j77FAiy=A$_ dSw=-7 dSi $7i$AA>-&_c d_7~U7A Ue[__}x=A_}x=A_x=A_x=A KL7Ah^Bc7C_{ox{[d{[`du[d(|[~3 d_[ d_[dFu-<7(x3z d_[ d_[ZDA_ BA@u[ d_[ d_[ FB__BA@_L_ FyC_1BFv
Fu?-%-
(Uu=%_D-O_"BA@K$__|QA}_t_oTy_i-_}A2A@_7 U7A U7A U7A U7A wA- encoding/xml.(*printer).marshalValue p val finfo startTemplate ~r3 tinfo typ err start i n err v name i finfo name err err s b err1 err X * @ 5 8
7 N ? O Y [ L b m D R + Z g i q u S c S F 2 @ C O 3 z
- v s
3 N ] & * L N ^ h { c & PR|&
}}|X c }}| ] b Pb PR q v Tv TU T C TUC G U g l Ql QS P PR ! R I ~ 2 7 P7 PR R } Q 7 QS P PR R R W QW QS H M PM n PRn ~ R Pa c | X a }a R F }F c R \ a P P F PR
P
PR
}
P , PR, W } y { Q Q & PR|&
}}|X c }}| & PR|&
}}|X c }}| P RP RI S R W \ P\ y PRy
} P PR I }
-y2NyG7@~d~[7 (yGB_Fx-NyG7(y2y(y[dy7@}d}[<L_BAx-NzG7Gy(y|[d u-<7{ d (7 v[( }3# F v3 ( v3 (_yQ( v3 P7y \(7$_y=d--y):_EAo!7 u-<76$^87sAF7sA$_-A2ACBC~oKv-$_Cs_7~__sz=A7 7y=A"ACpKl_7__-y=A"ACpKN_7_7y=AA@J@NiL_7__-y=AA@JBNiL_7_ { Ai-~__AYA@_7 U7A U7A U7A UKA yA encoding/xml.(*printer).marshalAttr p start name val ~r3 err s b err attr err attr text err text err n i err X
}i]_j-`7_AB7_B__&A*s
encoding/xml.defaultStart typ finfo startTemplate ~r3 start ` 5 5 k p Pp PR R
_7C_8A@KP__7v7j7|_?}w
encoding/xml.(*printer).marshalInterface p val start ~r2 err ` H X ! O * D m | N N r w Qw | QS| QST h m Pm PR R > C PC T PRT ] R N r w Qw | QS| QST
͜AA@AA FvK$_ Usv=AA}_
encoding/xml.(*printer).marshalTextInterface p val start ~r2 text err err M . N 8 8 8 @ 8
__ywe[4}7V}[ 7iB___V_j_AB__7sU_A_7t7-B_-Jrtw_AB_A__`__KB_w-q
encoding/xml.(*printer).writeStart p start ~r1 attr 8
R~ t
~~t x Tx RT R~ t
~~t x Tx RT
__+Ao_97iB____}_FbvG$b>-___~7A]U_A}xu7A__7-78-P7|Aw
encoding/xml.(*printer).writeEnd p name ~r1 h p * ! q 7
3 * - 1 X q s & * 7 9 J L W Y i k | ~
} ( n s S ( ! * - 1 " * - 1 X q s & * 7 9 J L W Y i k | ~ ( ( } 0 5 P5 : PR: S PRQj PP
PP PPP r XPPr PRQ } ( } } ( P ( P } ` & R & Q & R & R
udz)<77|G7x w3#( w3(_{)(_{=( w3(_{3( w3(_{)(_{)7A7 p3( |3(_t) ( p3(_t) (_s) ( p3(_s ( p3(_s) (_s)7A_Az=##_ zx7n x3(_|[(_|3K~<L_ |_<L_AIC_A7AF U$UU{Ak=A$ F7z=- Fi)3.#P7 C7!7s 7L_#A3 _ U7A 7+_KA3f
encoding/xml.(*printer).marshalSimple p typ val ~r2 ~r3 ~r4
~R0 bytes 0 @
! T T ` p u U ` p u u F T ` PQR` PQ
Q T ` PQR` PQ
Q T ` PQR` PQ
Q R R
͜A7s=u-d7#7zG F (7 ve( {3# ( v3 ( v3 (7{)( v3 (7'7$-%--{)`AAU7A z
encoding/xml.indirect vf ~r1 8 H - f y 4 < T F H I V
\ I X d l 5 `
` .
= \ & J R [ c
: C H ` c e m 0 9 @ V Z \ d # + 5 F T
v
4 @ D I K T V Y ` h j s u x " , . 7 9 <
5 M % Q & . 6 E R Z b V c k s
: C H ` c e m 0 9 @ V Z \ d # + 5 F T
v
4 @ D I K T V Y ` h j s u x " , . 7 9 <
5 M # % Q F T
v
4 @ D I K T V Y ` h j s u x " , . 7 9 <
5 M F ' 6 F [ - < H [ { " , . 7 9 < I K T V Y ` h j s u x
M ; [
e
5 ; j ; V s
: C H ` c e m 0 9 @ V Z \ d ( [ % K T ; [
: C H ` c e m * / * 2 0 9 @ V Z \ d % * ; S E b E b n w * o { : [ { # + # ( & J R [ c ? f
: C H ` c e m 0 9 @ V Z \ d # + 5 %
v
4 @ D I K T V Y ` h j s u x " , . 7 9 <
[ [ [ P P # ~K [ P Y # ~ QRP QR
P
2 7 P7 N PRN X R , 1 Q1 6 QS6 { QST{ } ST " ' P' N PRN Q R P PR R 2 7 Q7 < QS< } QST} ST ( - P- P PRP S R P PR R P PR P PR P [ PR N
S
PS
e
PR P 5 PR d STU P PR P P ~ ; ~6 K ~ R R P P C H PH \ PR\ R P : ~R:
~~ S
~T 0
U~~0 ~~ P PQ PSQ RSQ SQ & S SQ S RSQ RS S P PR E QPR P RP ^ c Pc w PRw R } P PR P PR / R [ k p Pp PR P
PQ PQS RQS
QS & S
QS S RQS
RS S P ~ ; ~ P : ~R:
~~ S
~T 0
U~~0 ~~ P PR 0 PRQ ! # X. 5 X P PR ~
R
I P
I P
P
: u P
P
[ ~ M P P PR ~
-7_-i-L7ASB7 F{)~ F~[^d F_ 7L7sB (A-|=BAD=-UA7V_QF~[^ dAR#YUU7._F~[^ dA~QnoU=7327MyABA@KN_KBx(u-7D
(r[l7sA[F~[^ dC_B_n_ro<L_-B yA}FAy3Fy2y d9_ydyyPE_-BUyAFAy3Zy<y d9_yydyyZ#N#%__eF~[^ dA 27LABA@KN_u_Z7#7y
d v3 (7 v3 ( v3#Z z3 ( v3 (_|[#( v3 P7'7$_|=d--|3B_ A@|(|G=7#7"8#2P[ABA@Kn_{G7@||[<L_BAx-N|G7H{({[dU7A_}FAxu-d7P7xG77 P p3#P {3(t) ( p3(t) (t)# F p3(t ( p3(t) (t)]A@ w3( w3(|)(|3( w3(|3( w3(|)(|)]A@7sAy=$_y _!A@7P77L7sANA@7|=A_A@F x3(7|3(|3KAy_ F,A@KF~[^ dF7{=A"ACKN_A@^F~[^$dF_-{=A"ACKv_A@jF~[^d F_BA@~F~[^dc=U_Ah_KA__R_=____ ___w_q__{___ __F_QAUiA U7A${}=FU=A
encoding/xml.(*printer).marshalStruct p tinfo val ~r2 s i finfo vf emit &scratch err data err err data err err err err err
~R0 err err elem err k dashDash dashLast err s b iface raw raw err err err @ j J O PO j PR
A~A ~r0 @ ! # - - h - Q
͜AuAB87'7 8w7&7!-w=F7j-t= FAtG2$89|oB-TAse F7s 2o
encoding/xml.(*printer).writeIndent p depthDelta i 0 P ! " # $ % D j v D j v 9 ` S h S D hD S % P% D PR
͝AAA- o'-7AA-$7BA@`A7j7=}|AA encoding/xml.(*parentStack).trim s parents ~r1 split i err 0 & ' ( ) * + / 1 R * * 8 < < P P < R P PR
"U7_iSA@__7A~#
encoding/xml.(*parentStack).push s parents ~r1 i err @ , - . / 0 1
AP
encoding/xml.(*UnsupportedTypeError).Error e ~r0 0 2 3 4 5 6 7 ' ! t } ! ' * . " ' * . ` f j t v " * , 9 @ N P X j } $ & A
uFx)<77%7 w3( y3(A})(A}=( w3(A}3( w3(A})(A})-AA7 ( p3#< p3(Av) ( p3(Av= (Av) ( p3(Av # F p3(Av) (Av)- x3(A~[(A~3-z L7J<#zo7P7y x3 Z (7 v3( y3# F v3# 2 v3 (A}Q( v3 (7}G(7$ACA-})7yo7$AAAxU7A |7
encoding/xml.isEmptyValue v ~r1 8 8 8 9 : ; < = c ! ! P
͜Zi,iUiAF7A~=A
encoding/xml.Unmarshal data v ~r2 ( 8 > ? @ A B C m m
A, ~r1 0 P D E F G H I &
+
k 3 ! & ) z w w w PRT PR R w w ` P Q P P PRT PR R
l=F U$AKU{sk=A F7z=- Fi)3.#P#vGu-<<7 U7A U7sA?
encoding/xml.(*Decoder).DecodeElement d v start ~r2 val J K L M A encoding/xml.UnmarshalError.Error e ~r0 p N O P Q R S Z ! L 8 = @ R < R i RXi < PX < `
͜A ds#v3tUA Ai
encoding/xml.receiverType val ~r1 t
~R0.data
~R0.itab 0 T U V W X Y @ 7 A ? A / ? C / 7 @ P 7 PR7 G R @ Q RQ R u Q Q
~[U($,A<--U-$-FU7A~=dh=F`-,t-~=V_nA?@_Z~Qj U\-UTA~=_ U\-UTA~=7_i7w
encoding/xml.(*Decoder).unmarshalInterface d val start ~r2 err ( Z [ \ ] ^ _ 1 4 B ) . L Q 1 4 B Q t y . @ Q ` . 4 @4 Y PY @ . 4 hQP4 e SQRe 3 hHP3 hXP hHP SQR t y Qy QS Q TS T QS Q. 3 Q3 @ TQ V QV ` T j o Po PR RL [ R R QR QI w Qw `
tyF|)-}_UCACBFz=KN-UBAwo2Ui7.ALBA!uX|F>#ZUBAyo2AFAQF?__-q
encoding/xml.(*Decoder).unmarshalTextInterface d val ~r1 depth buf t err t ` ( ` a b c d e ; 2 Z E
6 I %
3 }
2 ; > B 3 ; > B L R _ r z i r 8 C ' E Z
' 6 q S ` ` p - q ~ W ~
i PRQ ~~~ RQ P ~ O T PT q PRq
~ PR
p r Q Q i PRQ ~~~ RQ i PRQ ~~~ RQ
P
PR y ~ P 6 PR6 ~ P ` PR` R R P ` PR` R R ` ` P n Q ` P ` P i PRQ ~~~ RQ
P
PR
~ i PRQ ~~~ RQ P PR - ~
- ud~)<7 P7v \ F7$_v= dKv)L_A^_CAq%-wGwQ#8!AJ3(wB7sFx-NwG(wy(w5wy!R=-(R3#3-^e}L7sBAFx-NwQ#w=37sAmA-AtA-AAA?A?aAB_7 A-A _#A7_.Az=d U$UU{=_k[_ F7z=- Fi)3.#P#mG 7 __w=AA_w=A_w=AsA_w=AsU7A U_A U7A w#
encoding/xml.(*Decoder).unmarshalAttr d val attr ~r2 n err 8 f g h i j k
B E K ; E K G G L M
S Y [ y g f { f
&
3 V
u
3
a \ . V - , ' C M $ 2 2 N
" ) " 3 9 8 9 8 < ; G 0 K %! 2
U! 2
! 4 3 ! 4 ! S 7
# 7
N# 9 3 # 9 #
& d& M K' > J' \& & I ; o d n z ; f v G W j z
u
$
&
& & & 2' K' ' ' 8( ;( ( ( 0. 8 : @ J /
u
8 $
&
& & & 2' K' ' ' 8( ;( ( ( 0. [
c
6
O W e
m
%* 0. O W e
m
_* Y+ + - - 0. O W e
m
_* * Q+ Y+ + - - - %. 0. + + + - - - %. 0. W, , , , - )- 8- - - - * Q+ - %. * Q+ - . : U 8 $
&
& & & 2' K' ' ' 8( ;( ( ( ) ) ) *
* * %* ^% f% % % %
&
& & & & & 2' K' ' ' 8( ;( ( ( ) * %* 8 z 5 C " * I Q " - 0 [ c j r = E Z
"$ $ $ $ D I " - 0 [ c j "$ $ B$ b$ 4 [ c j "$ B$ I N 5 C " * I N X h $ "$ ( 0 P t ( . P # $ U! !
" j z h x }
" " " # # # < G . / v { { W \ ^ b y. . z z 0. y. M U " - ( 0 [ c U Z = E Z b I Q j r b j ( 5 C " * ' ' Z $ $ x } " " x } " "
V f h p $ $ / RPS > RP> {{ , RPS, o {{y . {{y. . RS Q - }- g Pg o }o / } E YE $ yC% q% yq% E& XE& ) y) * X 5 P5 6
{6
^
P E UE 0. { , RPS, o {{y {{y {{y {|y ||y |zy , |zy, @ |y@ O
|QyO |y
|Uy |y
|Ry |y
|Uy
|Uz P }}zP f TUPf TUC% & \_S& & {{y& & {{y& & {|y& ) ||y) ) \_S) . {{y. . RS y !
Py! !
Py! ! y! !
Ry! !
Ry! $ yC% q% ||yq% (& Y]R(& ) ||y) ) Y]R) ) Y]) * ||* * Y]R * %* Y] E ]_ZE $ {{yC% q% |yq% E& ZUE& & |y& &
|Qy& ( |y ( )(
|Qy)( .( ||y.( ) |y) ) ZU)
* Z_U
* * _U* * _* %* ZU E \E z
Qz QSz $ zC% i%
|Tzi% q% ||zq% %
|T% & |z& &
|Tz& ( |z( .(
|Tz.( ( |z( (
|Tz( ) |z) )
|Tz) ) |z) )
|Tz) )
|T) * |* %* |z , RPS, o {{y {{y {{y {|y $ {|y$ . {{y. . RS E YUX }zz U UX YUXM U RU ` QR` m TQRm T
{X Y{X
{X R{X {
Y{z B }{zB _ TQR_ g TRg r Tz U UX YUX U UX YUX U 0 UX0 B YUX1 > R> K RQK R RQS R RQ RQSf s Ps P P E TQR }zz R QR TQR T
{X Y{X )
{X) E R{XE m {m
Y{z }{z TQR_ g Qg r QRr w TQR Q QR TQR Q QR TQR ( Q( 8 QR8 B TQR P P-! 9! P9! F! PF! P! P X RX R XR 4 XRy4 "$ |yy$ $ |yy R RQ R i n Qn SQ /
}{ _ d Pd PR RY g P P P - }- / P , RPS, o {{y . {{y. . RS j P z P PR R
P / PR/
}} PR J V PV ` PQ` PTQ }{
}{ Q QS P PR P
PR x* 0. ~ + -, Y-, - y. 0. Y * * U+ -, U-, - z. 0. U + -, X-, - z + -, \ - - P- - PR- - R * * P @+ E+ PE+ Y+ PRY+ a+ R K% N% P% % [ % E& [& ' [ ]o $ y D I QI N
QSN X QSTX QSXT USXT UXT
UX X QXT QSXT QXT 5 QSXT5 @ USXT@ ` UXT` q
UXq X Q{XT { QSXT QXT
QT T QXT
QT 8 TS Z
QXZ e Qe U
QT
UT : ? P? PR R % PR% 2 R R R RQ Q R ( R^ i P P P } P( < P
P # PR# ( P J O PO c PRc P 2 5 R5 M QRM U Q Qy
{y R QR Q ) {R)
{y W \ P\ p PRp P P $ PR$ & R P PR R y !
Py! !
Py! ! y! !
Ry! !
Ry! $ y E ]_ZE $ {{y Q Q Q RPS > RP> {{ RPS > RP> {{ S
> S , RPS, o {{y . {{y. . RS , RPS, o {{y . {{y. . RS , RPS, o {{y . {{y. . RS P PR _ | P {R E
{y P o PRo R R P o PRo R R o ~ o P } Q o P o P z
P
PR
R
R z
P
PR
R
R
}
P
Q
P
P , RPS, o {{y . {{y. . RS P PR 3 | 3 8 P8 U PRU | , RPS, o {{y . {{y. . RS P PR o | E TXSE $ {|y E ]_ZE $ {{y y !
Py! !
Py! ! y! !
Ry! !
Ry! $ y E \E z
Qz QSz $ z RPQ |zy , |zy, @ |y@ O
|QyO |y
|Uy |y
|Ry $ |y / ]o $ y _ Z x X RPQ |zy , |zy, @ |y@ O
|QyO |y
|Uy |y
|Ry $ |y RPQ |zy , |zy, @ |y@ O
|QyO |y
|Uy |y
|Ry $ |y E ]_ZE $ {{y RPQ |zy , |zy, @ |y@ O
|QyO |y
|Uy |y
|Ry $ |y P PR | TUP P }}z TUP P }}z P PR ( | y !
Py! !
Py! ! y! !
Ry! !
Ry! $ y U! ! P U! ! P ! # ~ ! ! Q ! ! S ! ! Q ! ! Q # # P # # P f# # ~ f# # R t# # Q f# # R f# # R q% E& \_S& ' \_y' ) ||y) ) \_S) ) \_) ) _ q% E& ZUE& & |y& &
|Qy& ) |y) ) ZU)
* Z_U
* * _U* * _* %* ZU / :' l' U q% (& Y]R(& ) ||y) ) Y]R) ) Y]) * ||* * Y]R * %* Y] q% %
|T% & |z& &
|Tz& ( |z( .(
|Tz.( ( |z( (
|Tz( ) |z) )
|Tz) ) |z) )
|Tz) )
|T) * |* %* |z
-__7CACpKN_AM du_Z7(_w3$_C xu=-<7(7'7$-Cw)$(_ u-<7P7O7.-Cw)J7sA^7sA-xGxQ#6#_E[A7 (xQB7BAx-lxG(xy#PxyE F` <#2`:n}FL7sFx-lxG(x3}
Fu-<7(7f;O_7A7P7 F@A7eG7sA5}A_A Ud7BA~oU(~P7AACA@KJd-71(n[`7OA-_7 }[](q[7FA x=U~_Az=d U$UU{=_k[` F7z=- Fh) <#P#nG#\_u[7OB_VrB_}A_?w7AAt_}_Az=d U$UU{=_k[` F7z=- Fh) <#P#nGA:Fj=7sBA LF_-A_-A_A&A?a_B_7 _}x=Ab_ix=A]_}x=Aj_x=Amh_ K4d%##3dy=8dx[dx)(_ y[7<6j|3_^ !du_7CACBFFA^=Kb- Ui72_y)$B_{ny[__UUoUi72_yG$,B_{ky[Zx[-}UU_7AId_x)7B_0ACA@KJ'(x[(_xQ%_BA@x#$_7BA@x[Zx[_+x[_ x[_x[L_ |Q7_ -$U#}!W#_y)yG7?b|[Ff[(}[n}F_-y=AIA@b|[Fy)~G<K7sFx-NyG7(y2y(y[<|F7y=AIA@~[_7BA@ u_<7]7L_#A _KAF U$UU{_k[` F7z=- Fh3 <#P_D uA7!7L_#A_A _KAF U$UU{_k[` F7z=- Fh) <#P_E7q_t_i_~__|_U7A y |F7/_^}_7`A7^8Px)$7Add_z[dz[d_z=7Px)%]B7B_ |)7<6`5| U7ASF|)p dd[
d/sed[dy=7Px)$7A{b
duE7_x)$B7A~[
dzdu[d[dvG d@x?K34FK4K)4dBdU_7
dKj7$7B?A@o\7KL78At7(7$86x 7B_t-1_A$0A@{2x[cC__rUiA U7A U7A w
encoding/xml.(*Decoder).unmarshal d val start ~r2 saveXMLIndex tinfo saveData saveComment saveXML saveAny sv data comment saveXMLData err tok err &t v n typ err typ e
ok a handled any i finfo err finfo err i finfo savedOffset tok err &t consumed err err t t err err err t t
@ l m n o p q ] 8 / ^ X e E i ] w / 8 ; @ 0 8 ; @ J P ] p x w z QS
HP ( 0 0 F 0S c 0 0 0 0 # 0W 0 0 P R RQ Q ? x P D I RI V RQV x Q P PR R R PQ Q n p Q Q z QS
HP
P `R `
P `R ` P % XR% X
ud{)7 7P7y \F7$_y=d_y)L_A^_EA|[EZu-<7~- P7L__A{=A8K|vKqWSuF]{=Fg{= U7AWt-&A7A?_7B7d_m_A}A@K&AUA?_7B7|
x7L_w_AA@K&AAA?_7B7 __ArA@K&AA?_7B7 7$_kU%7A}[7[G_A5{A7AU%d_#A7C
encoding/xml.copyValue dst src err itmp err utmp err err value err ` r s t u v w / e _ e n " I N n x # " e b e " 2 : G \ _ i n , / t | 2 J J r @
(0@ X (0QX e (@Qe
X@ (0Q
(0 + @ : + @ : _ e e P P P \ P P 2 B R Q QS H b QSb H QS P PP ` h` P c S P PR R P PRb PR
_/1~)-L7BBA .y[^F`[c!C(z[;).A%=ucy`DA1[^ F?]z Fe2A(|[^Cdpdv Fx F _m=AeB^Fa}[-L-B7AWA_7CACBFv=K-Uy#~UA_7AI__HCA?BK'L_7BA@}F_=_[_~[_u[t=yAA- encoding/xml.(*Decoder).unmarshalPath d tinfo sv parents start consumed err
recurse i finfo j tok &t err err 0 x y z { | } > Q 4 9 P9 W PRW R P PR PR
͝A7CACF|=KN-U#VUBA7BA@F7AA
encoding/xml.(*Decoder).Skip d ~r0 tok err err ( ~ ? R ? S 2 ' \ ` b
+ \ H E d l k v
W \ H E d l k v
q E d l k v k v { k v { O k ] { P b } } P > PR> H R o t Pt PR R R M \ P[ | P ` }` R }x } 9 P > C RC W RQW Q ~ ~ P |R {
|}
|}
|} W P R < RQ< f Q x } P PR R P PR P P / RP/ E R J X P /
-_rU7A_Od x8_}=< UA_ 0#-A_ T_-_-_ we_ d7Aw=A((X[E_L_U$As_
P_KACA@KO_jUdy)F_KBA@~[h=AACA@KN_L-7oy Fz[s[n[F_U7A_BA@]_Xe[A encoding/xml.getTypeInfo typ 5 ~r1 5 ~r2 5 tinfo : ti l ti 6 n < i = finfo [ err [ f > t E inner J err J finfo Q err S err f ? ? 0 x u S { @ [ S / @ ! S : [ $ G
: G 3 ~ 7 ? K U Y
J U ~ P R} h
~}h u
~}u
~}
~} R RP 7 QRP7 ; QR; ? Q QRP QR * Q* 7 QRP7 ; QR; I Q 2 Q}P2 ~}} QRP $ QR$ G Q
QRP QR \ a Ua f URf URP RP / P R
-
UR-
J
U UR ) R U
[
h [\h [ [\ [ [ ! Y N c P / P/
~ P }R
}~ R RQ Q P R}
~} h P}
~} ; ? R? O RQO e Q j w Pw ~R
~} e UT UT * T* I UT W U}W
~} $ P$ 4 PR4 G R L Y PY ~R
~}
-U57 <7#w=AAtAKA7~= FA=X-7_4d{_ d7Ax=__AdUA _7_D-O7At7r
<_-_= Fi 7=AFy=_b^7X-~32d)s7L7o }y32d7~77AA-'[%](o<-_=_7AUA s_B_g{oQQ_-$7 <_s=?:##7\:4N7 :_7`_##A
(|o7797- ({G})C7 <7#x=__AdUA ]U-87dKAx=LUjA?vUAePUAz PsBA$sVA|#Ps7u7|Q~
encoding/xml.structFieldInfo typ q f q ~r2 q ~r3 q finfo r tag u tokens { parents
~R0.ptr {
~R0.cap {
~R0.len { i v valid flag mode xmlname xmlname ftyp u { L L h
~h P -
~ -
~
: R: ~ P - ~ - P -
-_t_s_D_D_{_i-_9_ _KABKj_p
encoding/xml.lookupXMLName typ xmlname i n finfo f AtAA ~r2 0 , 5 @ S @ S 2 t w T
[ c l % P X t w # H
6 > N V
6 f ` e
& P s & & P s
=
E
t w
X |RU H |||H |RU
|R | 2 |RU2 O
|UO | |RU
|
|U
|
|RU
|R
|
|U |||
|U [ P H |H ` P> |
P { \ H | | [ Y Y ~ Y |
Y
|
Y 4
P P PR & R + 8 P8 s |Rs
|| H P QP ` SQ` s S x P |R
|{
-_K2l[-L7A`dmcA2m[^dt_)d7k=2k Fdm^adDA87$_]t.dlGa dt=dm[^dndDL7'_Yp.dlGa
dp=dm[^dn dE7 _^l.dlGadl=`^adm=-n~=-7 ---L7V72#Kt7A_7_X_ d7#y=A 7#y=A_AUn7&4_0-L87"a)_k-7@x}yhy_{dm[^du-LA!`#{_A# encoding/xml.addFieldInfo typ tinfo newf ~r3 conflicts i minl
~R0 p i i f1 f2
~R0.ptr
~R0.len c i
A A
encoding/xml.(*TagPathError).Error e ~r0 @ j N / N M e N N _ j g UST UST
PX UST j
PX j Q Q j X j P R ` j ` UST
PX UST j
PX [ P @ j @ S S
_(7w=A9--"CA-BAMuA
v3 (7 v3 ( v3# x v3 ( v3 (AwQ#P v3 P7w ~=F78Aw=F--we[xNAAUsAD&}7_dU7A w
encoding/xml.(*fieldInfo).value finfo v shouldInitNilPointers ~r2 i x t ` # H ! * < R
͜A7ADAJA
encoding/xml.(*SyntaxError).Error e " ~r0 " # p H b PP
`` P`` * h`` :
#AABAA!
~r0 @ X A$ encoding/xml.StartElement.End e H ~r0 H 0 0 >
> e Pe h
A,AH
~r1 V 0 0 ] 3 e >
> e Pe h
~A,AK
~r0 ] ] 0 0 d 3 e >
> e Pe h
wA,AK
~r0 d d P @ n 3 G L V PV r RXr `X L r PPr w
XXw PXX hXX
BAm7AAA-
~r0 m n 0 0 w 3 e >
> e Pe h
dA,AK
~r0 w w 5 d 3 7 w 3 m 6 T n 3 } 4 ] 3 1 Q k 1 < m \ w 8 R P} Q
}} R P} 1
}} ` h Rh P}
}} 1 } | 8 ~ R P} 1
}} R P} 1
}} RR }}
P}} 1 }}} ` h Rh P}
}} ` h Rh P}
}} ` RR }}
P}} }}} \ } P R}
}} PP }}
P}} }}} R P} Q
}} R P} Q
}} RR }}
P}} Q }}} 8 PP }} U
P}}U 8 }}}
-___jw7A#AA__{d7A%AA ~__~_o_m7AAF_b|~__e~7A!AA___ @__BA=F_h_w
encoding/xml.CopyToken t z ~r1 z v | v ~ v v v d w n } ] = y 4 ? 7 9 V 4 7 Y 4 < Y R P R P P
RP
R ( C P Q x Px Q x Px } P
AhU7ABU#AiUrC~~/ U_Br`-7}_.#x})}=U7AtUAFiA_ĈU#AUF7~=_|#
encoding/xml.NewDecoder r ~r1 d
~R0 ? ? 9 j P
͝AAAhUAABU#AsUtA7t~~/Axo
encoding/xml.NewTokenDecoder t ~r1 d (
M < # D E < ~ I B p > G < : C
>
@ C V
> W
& F P , ; e ~ t O T W \ p
%
* H - W
|
. ; e *
* H - W
|
.
* H -
W
| t O T W \ %
*
e h p ) 8 { h p _ g _ g q t G O T W \ k S V _ g q t G O T W \ k
" , S V \ _ b e q G
* H
- W Z
* H ] | W Z
W
F I L O W Z |
X
% 8 P PU F STF
}} ST K T} T. 3 S3 @ ST UQ ~ ST
S
%
ST R RQ RTQ RT R R}Q }} ST $ T$ Q ST K P PP PR R e i 8 r
8 ~
X QX | D Q
R
O RPO
}| ! RP! < R V
Q
|
Q M
Q
RQ
RP
}|
q RPq R P x } ~ 8 M Q RQ p RPp r Rr RP R R 8 8 D H RH RP 8 ;
Y 8 Y
Y 8 R T RPT x R 8
S
X STX
}} ST L S
R
O RPO
}| ! RP! < R
X QX | D Q X 8
X X] X 8 M
Q
RQ
RP
}|
q RPq R V
Q
|
Q
T 8 g
T
T
-_U U}iBvxy=`J-_FoVA'qdm2-Ui-l_xUi7 771#U-_g[d$i$_e }7AX_8CboF_#WUj U7A~7)_v _c71#U+_ d`[$i$_ (d_iKL_Z7k-g Fc7i 2) 2,) U$A `[$A_ [ F) F_GV-$-Q 2~o (UiA5FL3dNo- 2r`U7U#1F7_7bFt=UA_U)_d@_V-$-Q 2m) 8 U7A=F?E_- 2a,`U#U[ d 2_8P7~2G[927.~3UjF|[ i U @_V-$-WQ U7A=FC=_#B`U7Us_8x_~2~)2G[927.~)U AzC] 7d
encoding/xml.(*Decoder).Token d ~r0 ~r1 t err t1 t1 a ok v ok v i t1 8 R N RPN R R
͝A8t- Y$t7_/!/!1#$uA)AAVAWtoA7
y ? 9 /
* * ^ c Pc RP R * * P P * P * ^ P *
U~r`_}_.#x})}=UiAtUAFi`A_jU#AUF7Cz-
? 9 - e Rj R
͜AV-$-WWU7ACA#LA8U-U!WBAzo
~r1 + R U
͈AV-$-u`-UT1-C-A}e-
~r0 - > R> R h R T Q Q
͟AV$,A<--V-$-WQFU7AD@`-,t-Bno
? 7 8 M W
͈A\- _o`-UT a)-"FAfAg
~r0 ( > & ! & - o R - e Rj R
H8FHQ-$-WWU7ACA#L`U7U!W1FA2p
0 > & ! & - , , , , ( o , R , - e Rj , R
A?FAQ-$-WWU7ACA#L`U7U!W8FAAA.o
(
U A
~r1 P ! " # $ % ? : D D q D c ? 2 : A > A @ C 6 9 A h U? ` P
P U A h U? ` P
P U P ~R i
~~ P ~R r
~~ P ~R e
~~
- dQV-$-/`-UR/1-> 2+_K7 dP_ w_ Z`__UHUoi=AAA-UjG2a_yac_\\-LV-" 2-7{<B_7Gm=AAA-UmG2`_z_ v=AAA- UvQ 2_
_U-, x)UT 0-? 27LUdU_cAA encoding/xml.(*Decoder).popElement d t ~r1 s 0 p & ' ( ) * + O ~ k u u a f Sf ~ ST u @ P PR
͜A7BA`r-V 727z)A7AA A7R#)7gz
encoding/xml.(*Decoder).autoClose d t ~r1 ~r2 name s ( 0 , - . / 0 1
͜AtUiA7 encoding/xml.(*Decoder).RawToken d ~r0 ~r1 ( 2 3 4 5 6 7
O D g m b D O D X D } R D > O D b
T
X D s = ' y ? 9 1 O P C O ; @ D / 6 D h! ) D # N m ; H ( ' ( : 0 ' ( : X } r ? D F N h ' ( : X r 3 R g ' ( b
# J O H 3 R g L ' ( b
O H O
&
k
s
x
# ( # . 3 J
&
k
s
x
# ( . 3 J . 3 8 @ J
Q | @ Y / .! h! ! ! (" # $ 9 ` c
J O # ( ' ( : ' ' $ P
P P P6 L {L c Pc {@
P J {x Pd { P{ 7 { {1 P a P }TU }|| }|| }|| }|| $ }|| P $ PR$ < PRQ} RQ Q P R {R s {s 7 {7 { { $ ) P) E PRE
|{ R
|{ R RQ R G PRG |{ PR R PR L Y PY |R
|{ P RP R P 7 |R7
|{
|{ Q QS E QTSE B }||B QTS P / PR/ E RB R P|R
}| R
{
;
P;
{
{
{ J {J S {
S { / 6 {6 > {> $ { 6 6 {6 [ {[ {
{
$ { R RQ R PR P PR PRQ
RQ P Q S S {S j Pj { 5 = {= { 5 { ( {( ; P; {% J {
@ {@ J R ! ~ $
P $ q R{ } $ $ $ P |R
|{ Q }`
S } V Rc $ | $ $ P P $ # T T $ $ Q QS E QTSE B }||B QTS J O PO RP R Q QS E QTSE B }||B QTS Q QS E QTSE B }||B QTS R P B | P B | [ P Q QS E QTSE B }||B QTS $ 1 P $ a P $ $ $
-_UUPitO#P_7A #G#P#P #$_k_V~Q8nG8ZNV}=_}oU7AU-U ~_7)FVo)Z\_7 |=_``Z7~_~oU7AU-U m_7 FAv~_oU7A U-U |[_7B_7AL_,=AAA- U[ 2`U 7VA ~_$8_7A#P### {=_``Z7`7KA:M=_7A { _``Z7~U7AUU _#~_#_#{ #$_k_V|Q7BDp-&7sA!_#|_#~V7RA }773 c(|e3i_7BAAn {_< {3j7sA!~U7AUU }_$ {[F(gy4_7AA2g[Fg[Fl[(_t(t[ FpA(n[ z=_ z32AAA!J_$_k3<k[__CA~(N##N#K#'N=u3
F7V_AAA_ #z_7$ ``U( z Z z3-uG7
-N73(&~ d44iA<_iO=Fdx=_ #z]UFB,An3F@`- zQF_~_7AA~U7AUU _$_BDp-&7sA!_#cGi_ABA {_n {3kA {b_sBA Cr-B7AvU UFy-E?%]$_7iA }o}=FF=Km-}G}[g[d}UBr`_}v_.#U7AUAF__U#_!UKF_7x_U ~7AtU t (_a_$_A o {[FPG_7B_7A#P#N #$_k_V~Q_i(_7B_7A#$_m <#$WVQ_%_7B_7BKNX )d_JV)diV/d~}=UiAUU _#w_#}_}oU7AU-U [Z=_7A&#P_V_P-}U7AUU _#_#~
encoding/xml.(*Decoder).rawToken d ~r0 ~r1 b
empty attr
~R0 ? data b0 target data
~R0.ptr content ver enc newr err inquote depth b0 b1 data data i b0 b1 i j a T X ?
9 @ 8 9 : ; < =
e O Z f a D q O u " S Y e 4 P P e 4 P P{ e h e e P
͜AK #AF #$WV yQ``Z7|oU7AU7AA7 AA}=AiO-- #$AkAV xQ7 y=2Ay7 yA A# encoding/xml.(*Decoder).attrval d ~r0 b > ? @ A B C O H I n 0 P 0 P
A7At'-< #$AkAV@Q~oo
encoding/xml.(*Decoder).space d b 0 D E F G H I - - -
͜AUu}C75_&U=<lB^-$WV7zA|A
encoding/xml.(*Decoder).getc d b ok J K L M A
encoding/xml.(*Decoder).InputOffset d ~r0 N O P Q
, Q , R R A yQ7<V607> ~r0 0 R S T U V W D + + + +
͜AtAr`'o| U7AUs7~
encoding/xml.(*Decoder).mustgetc d b ok X Y Z [ + + A8AkAVV 0 x \ ] ^ _ ` a
2 . O T 8 O : ) e D O D O D m D /
q Q r D
# O %
R V D ` I
T
X c U ) 2 H Q f % 2 < > K P O L z
L r u I Q U ) 2 H Q f z
L r u I ` W z
e
) 2 H Q f % /
X ~ ) 2 H Q f > K /
X ~
L r u c o }o w }w } c o Po } : }: } P R RQ R TR ~ TR R RQ R TR P~~ 8 TRP8 P~~
~P P~~ TR PA P P= [ P{ P : }: K P S Pj P + R+ }& } Q Q
P R RP R RP R
P
PR
R
QR
Q QR Q \ e Re QR Q QR ~ ~ T } j
|
P
P
2
R2
} P P
S } 3 = R= e Q}e
} < P A R U c Rc X A P P < P
P
HR H} S P P @R @~ + R+ }& }
-_ y[`Z7 ( d3w37AAtPA =#g gQ d_#\G#2P x__iE_7A# P#$_k_V ZiZ[$_i# #$_k_VU d x=_<A x3 xe`_s@$5AUA
ZrB_-BUw_U_Ax[ AiFw]CGy_7B_7A#k_AB_7A
v[ x__F= <#9-v_7>=q= d d=_iB=q= d d~=x x {=UiAU7_ER_~U-({=UKAU7 xx4F77i7}77Px x x w7 w) we wyP~=_3|U7AU7{dwnw[-L7sAjA_ --L-L-KKrGKz=U7AU77A<zAAA-UzQ2`7_}[zy w[ddy=7t7#7t#%77B_AA# #$WVU P x=7- _iB_ABKA [#P- d w=7A&A:>_iCs_U{=A_A0U{Q2`7 xAB ``Z x VuG7
-N-_A d W=7 x{UF@ wGF xyd xA
encoding/xml.(*Decoder).text d quote cdata ~r2 b0 b1 trunc data buf
~R0.ptr b before
ok haveText text ent
~R0 base start
~R0 n s name
~R0.ptr
~R0.len s r size T X b c d e K J K 7B-$-$-`K_A$A7 0 @ f g h i j k 4 @ H R T ] j ( W ( W ( 9 @ R@ u QRu J h`J W QRW j h` P
͜A~$Pq7#Ax}BA}A~=&7aAzG7P_y-
encoding/xml.(*Decoder).nsname d name ok s i ` l m n o p q
! Q D R F l o
s y T S `R
`P
P
hR
hX
͜A w[`Zi wA w3dAUA~_zA#A%UzG2`7_A{7 wA 7
encoding/xml.(*Decoder).name d s ok b
~R0.ptr
~R0.len 0 r s t u v w U H O u U O 5 ` 4 P P 4 P 4 P P P
͝Av#(-B-B-L#m$~#$AkAVZAuA| 7 xAK}=A7A#(-B-B-t#w$~#$AkAVZA|o7woA- encoding/xml.(*Decoder).readName d ok b x y z { = A`-B-`#7 ~r1 X | } ~
hX` QTS Q` hX` Q P P+ ^ P^ L P L U R P P
͜AlAAA`AuUA}oAx-LKB6`AAAA;U)AvAvA{o}x
encoding/xml.isName s ~r1 c n H h` QS ` | h`| B | P . P. ^ T^ m Pm | T G o Ro X X
͜ADAiAA`AuUA}oAx-LKB7AAA^;U%AvAvA{o}xA7 encoding/xml.isNameString s ~r1 c n 8 H
A?A# ~r2 @ p Q & ! " * R Z t & 5 = \ d { n v % 6 W ] ` c l r w " * R Z t & 5 = \ d { i v % 6 Z ] w | = B " v y % - " i ~ E E E ( ? ` P` c Sc R @ ` R U UX UXY U " UX" / UXYD K UK R UXR f UXYf m Um t UXt UXY U UX UXY U UX UXYN U UU \ UX\ m UXYm t Ut { UX{ UXY U UX UXY hPX P PR c P H ` P0 E P P B Pm P R P ' PR' + R \ a Pa y PRy ~ R~ PR P B Pm P
͞_2f).,-LJFg=A.J2!-y 2qG(x=CUUr
dF-r .LU|d FUkq=0%- 0$UzdCUxdA`-M-y -$-$-$-`K`KxUi[ d?>Uhdw Ut d!Uv dAheF5A@bAA@c[> d2?__-'AT|g[_AA encoding/xml.escapeText w s escapeNewline ~r3 last esc err i r width err err p Q ! G J M P Y _ d 7 M PM P SP R : @: ` R T TU TUX T TU TUX T TU TUX & T& - TU- 2 TUXL S TS Z TUZ f TUXf m Tm t TUt TUX T TU TUX T TU TUX T " TU" z TUXz hPX P P : H: ` P P P ' P I R P ' P
͞_Pi).,-LJFj=A`.J2!-y 2LUU-u .LU Ut0%-G0$UU$-M-y -$-$-$-`K`KxUd?>Uz UU Ajj=Fr AhF/C-ryj[_
encoding/xml.(*printer).EscapeString p s last esc i r width ( H X " " & X i i i i
F3A Fq encoding/xml.Escape w s 8 ` . x x Q _ d - G - hX` +
QR`+ hX` P PR k p Pp PR R 0 P0 R L PL U R P PR R P PR R ~ P PR R
͜_DUA@c$_7te-A$AB-MAfDA@UA@bUnA{__AAA@`_UARw=Ay
encoding/xml.emitCDATA w s ~r2 err err i err err err 0 p e e @ PJ u P R E SE h S h
͞A AA7NA -N77#$7x77&7--7}77yA|A# encoding/xml.procInst param s ~r2 idx v ( Z 2 a Z Z B - Z . Z % L / Z
0 Z 1 Z _
: ? @ R X ~ ~ 9 C ~ ~ ~ ~
-K ds#x37#U ds#x37 U ds#x37!_ @ ds#w3U`U Ps#w37 U ds#w37 U Fs#w37 ~7A
Fs#u3UPU7AUAjUKA~U}A~U}A~U}A~U}AyU#AiUxUA7UWUAv
encoding/xml.init 1 A encoding/xml.(*printer).Available ~r0 A encoding/xml.(*printer).Buffered ~r0 A encoding/xml.(*printer).Flush ~r0 0 % % A- encoding/xml.(*printer).ReadFrom r n err A_ encoding/xml.(*printer).Reset w A encoding/xml.(*printer).Size ~r0 8 % % ( A- encoding/xml.(*printer).Write p nn err A encoding/xml.(*printer).WriteByte c ~r1 ( % % A- encoding/xml.(*printer).WriteRune r size err 0 A- encoding/xml.(*printer).WriteString s ~r1 ~r2
7 go.builtin.error.Error ~r0 (
V7s
type..eq.encoding/xml.Name p q r (
7s
type..eq.encoding/xml.Attr p q r @ 4 . ] 3 I < D RD e PXe `X < D RD e PXe `X < e RRe j
XXj PXX hXX
_ ~7AA}# encoding/xml.(*CharData).Copy ~r0 ] c b ] b1 ] @ 5 . d 3 I < D RD e PXe `X < D RD e PXe `X < e RRe j
XXj PXX hXX
_ w7AA}# encoding/xml.(*Comment).Copy ~r0 d c b d b1 d 0 0
7) encoding/xml.TokenReader.Token ~r0 ~r1 (
nA-A
type..eq.encoding/xml.stack p q r @ 1 . PP
P \ \
M;AAABA*_ encoding/xml.(*StartElement).Copy ~r0 @ attrs e ( @
2 % x
iAs 7AK encoding/xml.(*StartElement).End ~r0 H e (
[7s
type..eq.encoding/xml.EndElement p q r ` `
_[" encoding/xml.Unmarshaler.UnmarshalXML d start ~r2 @ ! 7 . w 3 I < D RD e PXe `X < D RD e PXe `X < e RRe j
XXj PXX hXX
_ d7AA}# encoding/xml.(*Directive).Copy ~r0 w d b w b1 w ` ` " # $ % & '
_[" encoding/xml.Marshaler.MarshalXML e h start h ~r2 h ( ) * + , -
7_ encoding/xml.printer.Available ~r0 . / 0 1 2 3
7_ encoding/xml.printer.Buffered ~r0 4 5 6 7 8 9
7 encoding/xml.printer.Flush ~r0 8 : ; < = > ?
u u
7= encoding/xml.printer.ReadFrom r n err @ A B C D E p
7}" encoding/xml.printer.Reset w F G H I J K
7_ encoding/xml.printer.Size ~r0 @ L M N O P Q
7IA encoding/xml.printer.Write p nn err ( R S T U V W
7& encoding/xml.printer.WriteByte c ~r1 0 X Y Z [ \ ] f f
7-7 encoding/xml.printer.WriteRune r size err 8 ^ _ ` a b c
7= encoding/xml.printer.WriteString s ~r1 ~r2 p d e f g h i
A encoding/xml.MarshalerAttr.MarshalXMLAttr name w ~r1 w ~r2 w 0 h j k l m n o 6 . n 3 P R
PP
P @ H
5 Am7AAA# encoding/xml.(*ProcInst).Copy ~r0 m b n b1 n p ( p q r s t u y y h y
*7s type..eq.encoding/xml.SyntaxError p q r ( v w x y z { v v b v
7s
type..eq.encoding/xml.TagPathError p q r | } ~ + / R/ B RP
i#A-7 encoding/xml.(*UnmarshalError).Error ~r0 e P P
7= encoding/xml.UnmarshalerAttr.UnmarshalXMLAttr attr ~r1 0
776As
type..eq.[2]interface {} p q r 0
776As
type..eq.[3]interface {} p q r 0
776As
type..eq.[4]interface {} p q r 0
776As
type..eq.[5]interface {} p q r 0
77#U7s
type..eq.[8]string p q r basefontbrarealinkimgparamhrinputcolframeisindexbasemeta<!----><??><!>xml/:_xmlns:="" xmlns="truefalse--()F ,: and >versionencodingutf-8CDATA[!--=ltgtampaposquotnbspiexclcentpoundcurrenyenbrvbarsectumlcopyordflaquonotshyregmacrdegplusmnsup2sup3acutemicroparamiddotcedilsup1ordmraquofrac14frac12frac34iquestAgraveAacuteAcircAtildeAumlAringAEligCcedilEgraveEacuteEcircEumlIgraveIacuteIcircIumlETHNtildeOgraveOacuteOcircOtildeOumltimesOslashUgraveUacuteUcircUumlYacuteTHORNszligagraveaacuteacircatildeaumlaringaeligccedilegraveeacuteecirceumligraveiacuteicirciumlethntildeograveoacuteocircotildeoumldivideoslashugraveuacuteucircuumlyacutethornyumlfnofAlphaBetaGammaDeltaEpsilonZetaEtaThetaIotaKappaLambdaMuNuXiOmicronPiRhoSigmaTauUpsilonPhiChiPsiOmegaalphabetagammadeltaepsilonzetaetathetaiotakappalambdamunuxiomicronpirhosigmafsigmatauupsilonphichipsiomegathetasymupsihpivbullhellipprimePrimeolinefraslweierpimagerealtradealefsymlarruarrrarrdarrharrcrarrlArruArrrArrdArrhArrforallpartexistemptynablaisinnotinniprodsumminuslowastradicpropinfinangandorcapcupintthere4simcongasympneequivlegesubsupnsubsubesupeoplusotimesperpsdotlceilrceillfloorrfloorlangranglozspadesclubsheartsdiamsOEligoeligScaronscaronYumlcirctildeenspemspthinspzwnjzwjlrmrlmndashmdashlsquorsquosbquoldquordquobdquodaggerDaggerpermillsaquorsaquoeuro ¡¢£¤¥¦§¨©ª«¬®¯°±²³´µ¶·¸¹º»¼½¾¿ÀÁÂÃÄÅÆÇÈÉÊËÌÍÎÏÐÑÒÓÔÕÖ×ØÙÚÛÜÝÞßàáâãäåæçèéêëìíîïðñòóôõö÷øùúûüýþÿƒΑΒΓΔΕΖΗΘΙΚΛΜΝΞΟΠΡΣΤΥΦΧΨΩαβγδεζηθικλμνξοπρςστυφχψωϑϒϖ•…′″‾⁄℘ℑℜ™ℵ←↑→↓↔↵⇐⇑⇒⇓⇔∀∂∃∅∇∈∉∋∏∑−∗√∝∞∠∧∨∩∪∫∴∼≅≈≠≡≤≥⊂⊃⊄⊆⊇⊕⊗⊥⋅⌈⌉⌊⌋〈〉◊♠♣♥♦"&<ŒœŠšŸˆ˜ –—‘’‚“”„†‡‰‹›€UU)rT+NV
* UUUe xml: EncodeToken of Comment containing --> markerxml: EncodeToken of ProcInst xml target only valid for xml declaration, first token encodedxml: EncodeToken of ProcInst with invalid Targetxml: EncodeToken of ProcInst containing ?> markerxml: EncodeToken of Directive containing wrong < or > markersxml: EncodeToken of invalid token typehttp://www.w3.org/XML/1998/namespacexml: EncodeElement of StartElement with missing namereflect.Value.IsNilreflect.Value.CanInterfacexml: %s.MarshalXML wrote invalid XML: <%s> not closedxml: start tag with no namexml: end tag with no namexml: end tag </%s> without start tagxml: end tag </%s> does not match start tag <%s>xml: end tag </%s> in namespace %s does not match start tag <%s> in namespace %sreflect.Value.Intreflect.Value.Uintreflect.Value.Floatcan't happenxml: bad type for comment field of %sxml: comments must not contain "--"xml: unsupported type: non-pointer passed to Unmarshalxml: %s.UnmarshalXML did not consume entire <%s> elementunknown type expected element type <> but have <expected element <> in name space but have no name spacecannot unmarshal into ParseBoolxml: invalid tag in field %s of type %s: %qxml: namespace without name in field %s of type %s: %qxml: trailing '>' in field %s of type %sxml: %s chain not valid with %s flagxml: name %q in tag of %s.%s conflicts with name %q in %s.XMLName%s field %q with tag %q conflicts with field %q with tag %qXML syntax error on line unexpected EOFunexpected end element </element <> closed by </> in space closed by </bytes.Buffer: truncation out of rangeexpected element name after </invalid characters between </expected target name after <?xml: unsupported version %q; only version 1.0 is supportedxml: encoding %q declared but Decoder.CharsetReader is nilxml: opening charset %q: %vCharsetReader returned a nil Reader for charset invalid sequence <!- not part of <!--invalid sequence "--" not allowed in commentsinvalid <![ sequenceexpected element name after <expected /> in elementexpected attribute name in elementattribute name without = in elementunquoted or missing attribute value in elementunexpected EOF in CDATA sectionunescaped ]]> not in CDATA sectionunescaped < inside quoted string (no semicolon)invalid character entity invalid UTF-8illegal character code %Uinvalid XML name: xml: cannot use RawToken from UnmarshalXML method % % *xml.Name encoding/xmlSpaceLocal *xml.AttrNameValue
*xml.CharData !*func(*xml.CharData) xml.CharDataCopy *func() xml.CharData *func(xml.CharData) xml.CharData *xml.Comment *func(*xml.Comment) xml.Comment *func() xml.Comment *func(xml.Comment) xml.Comment *[]string *[]uint8 *[8]uint8
*[8]string *map.bucket[string]string topbits keys elems overflow *map[string]string +*func(string, io.Reader) (io.Reader, error)
*xml.Token *func() (xml.Token, error)*xml.TokenReaderToken
*xml.stack next kind name ok *xml.Decoder
*interface {} '*func(*xml.Decoder, interface {}) error *[]xml.Attr*xml.StartElement (*func(xml.StartElement) xml.StartElement*xml.EndElement &*func(xml.StartElement) xml.EndElementAttr *func() xml.StartElementEnd *func() xml.EndElement )*func(*xml.StartElement) xml.StartElement '*func(*xml.StartElement) xml.EndElement :*func(*xml.Decoder, interface {}, *xml.StartElement) error *func(*xml.Decoder) int64 &*func(*xml.Decoder) (xml.Token, error) *func(*xml.Decoder) error *func(*xml.Decoder) []uint8 0*func(*xml.Decoder, xml.Token) (xml.Token, bool) !*func(*xml.Decoder) (uint8, bool) "*func(*xml.Decoder) (string, bool) $*func(*xml.Decoder) (xml.Name, bool) *func(*xml.Decoder) *xml.stack *func(*xml.Decoder) bool )*func(*xml.Decoder, *xml.EndElement) bool #*func(*xml.Decoder, int) *xml.stack *func(*xml.Decoder) *func(*xml.Decoder, xml.Name) )*func(*xml.Decoder, string, string, bool) *func(*xml.Decoder) int *func(*xml.Decoder, io.Reader) !*func(*xml.Decoder, string) error &*func(*xml.Decoder, int, bool) []uint8 $*func(*xml.Decoder, *xml.Name, bool) *func(*xml.Decoder, uint8) ;*func(*xml.Decoder, reflect.Value, *xml.StartElement) error 2*func(*xml.Decoder, reflect.Value, xml.Attr) error +*func(*xml.Decoder, xml.StartElement) error*xml.Unmarshaler UnmarshalXML =*func(*xml.Decoder, xml.Unmarshaler, *xml.StartElement) error *[]int *xml.fieldFlags *xml.fieldInfo idx xmlns flags parents 8*func(*xml.fieldInfo, reflect.Value, bool) reflect.Value value (*func(reflect.Value, bool) reflect.Value *[]xml.fieldInfo
*xml.typeInfo xmlname fields \*func(*xml.Decoder, *xml.typeInfo, reflect.Value, []string, *xml.StartElement) (bool, error) 3*func(*xml.Decoder, encoding.TextUnmarshaler) errorDecode *func(interface {}) error
DecodeElement ,*func(interface {}, *xml.StartElement) error InputOffset
*func() int64RawTokenSkip
*func() error attrval *func() []uint8 autoClose "*func(xml.Token) (xml.Token, bool) getc *func() (uint8, bool) mustgetc *func() (string, bool) nsname *func() (xml.Name, bool) pop *func() *xml.stack popEOF *func() bool
popElement *func(*xml.EndElement) bool push *func(int) *xml.stack pushEOF *func() pushElement *func(xml.Name) pushNs *func(string, string, bool) rawToken readName savedOffset *func() int space switchToReader *func(io.Reader) syntaxError *func(string) error text *func(int, bool) []uint8 translate *func(*xml.Name, bool) ungetc *func(uint8) unmarshal -*func(reflect.Value, *xml.StartElement) error
unmarshalAttr $*func(reflect.Value, xml.Attr) error unmarshalInterface /*func(xml.Unmarshaler, *xml.StartElement) error
unmarshalPath N*func(*xml.typeInfo, reflect.Value, []string, *xml.StartElement) (bool, error) unmarshalTextInterface %*func(encoding.TextUnmarshaler) errorStrict AutoCloseEntity
CharsetReader DefaultSpace r t buf saved stk free needClose toClose nextToken nextByte ns err line offset unmarshalDepth*xml.Directive #*func(*xml.Directive) xml.Directive *func() xml.Directive "*func(xml.Directive) xml.Directive *xml.Encoder '*func(*xml.Encoder, interface {}) error 9*func(*xml.Encoder, interface {}, xml.StartElement) error $*func(*xml.Encoder, xml.Token) error *func(*xml.Encoder) error #*func(*xml.Encoder, string, string)Encode
EncodeElement +*func(interface {}, xml.StartElement) error EncodeToken *func(xml.Token) errorFlushIndent *func(string, string) *[]xml.Name *xml.printer *func(*xml.printer) int *func(*xml.printer, string) *func(*xml.printer) error -*func(*xml.printer, io.Reader) (int64, error) *func(*xml.printer, io.Writer) )*func(*xml.printer, []uint8) (int, error) *func(*xml.printer, uint8) error '*func(*xml.printer, int32) (int, error) (*func(*xml.printer, string) (int, error) "*func(*xml.printer, string) string *func(*xml.printer) E*func(*xml.printer, *xml.StartElement, xml.Name, reflect.Value) error +*func(*xml.Encoder, xml.StartElement) error*xml.Marshaler
MarshalXML :*func(*xml.printer, xml.Marshaler, xml.StartElement) error I*func(*xml.printer, reflect.Type, reflect.Value) (string, []uint8, error) 7*func(*xml.printer, *xml.typeInfo, reflect.Value) error C*func(*xml.printer, encoding.TextMarshaler, xml.StartElement) error K*func(*xml.printer, reflect.Value, *xml.fieldInfo, *xml.StartElement) error #*func(*xml.printer, xml.Name) error *func(*xml.printer, int) ,*func(*xml.printer, *xml.StartElement) error AvailableBuffered EscapeString
*func(string)ReadFrom *func(io.Reader) (int64, error)Reset *func(io.Writer)SizeWrite *func([]uint8) (int, error) WriteByte *func(uint8) error WriteRune *func(int32) (int, error) WriteString *func(string) (int, error) cachedWriteError createAttrPrefix *func(string) string deleteAttrPrefix
markPrefix marshalAttr 7*func(*xml.StartElement, xml.Name, reflect.Value) error marshalInterface ,*func(xml.Marshaler, xml.StartElement) error
marshalSimple ;*func(reflect.Type, reflect.Value) (string, []uint8, error)
marshalStruct )*func(*xml.typeInfo, reflect.Value) error marshalTextInterface 5*func(encoding.TextMarshaler, xml.StartElement) error marshalValue =*func(reflect.Value, *xml.fieldInfo, *xml.StartElement) error popPrefix writeEnd *func(xml.Name) error writeIndent
*func(int)
writeStart *func(*xml.StartElement) error *func(xml.printer) int *func(xml.printer) error ,*func(xml.printer, io.Reader) (int64, error) *func(xml.printer, io.Writer) (*func(xml.printer, []uint8) (int, error) *func(xml.printer, uint8) error &*func(xml.printer, int32) (int, error) '*func(xml.printer, string) (int, error)Writer encoder seq indent prefix depth
indentedIn
putNewline attrNS
attrPrefix prefixes tags p !*func(xml.Name) (xml.Attr, error)*xml.MarshalerAttrMarshalXMLAttr
*xml.ProcInst !*func(*xml.ProcInst) xml.ProcInst *func() xml.ProcInst *func(xml.ProcInst) xml.ProcInstTargetInst*xml.SyntaxError *func(*xml.SyntaxError) stringError *func() stringMsgLine*xml.TagPathError *func(*xml.TagPathError) stringStructField1Tag1Field2Tag2*xml.UnmarshalError !*func(*xml.UnmarshalError) string *func(xml.UnmarshalError) string *func(xml.Attr) error*xml.UnmarshalerAttrUnmarshalXMLAttr*xml.UnsupportedTypeError '*func(*xml.UnsupportedTypeError) stringType *xml.parentStack '*func(*xml.parentStack, []string) error *func([]string) error trim stack **xml.stack
*[64]uint8 *[1]int *[]interface {} *[1]interface {} *[]reflect.Value *[1]reflect.Value *[2]interface {}
*[32]uint8 *[3]interface {} *[4]interface {} *[4]uint8 *[5]interface {} *func(io.Writer, []uint8) error *[]int32 *[8]int32 *map.bucket[string]int32 *map[string]int32 *[]unicode.Range16 *[112]unicode.Range16 *[13]string *[190]unicode.Range16 *[252]stringUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUUU vc >lo TH 2 ܯ / < Ї 3 FE AV; ܯ t bufio bytes encoding errors fmt io reflect strconv strings sync unicode unicode/utf8 ( (08@H 7 1111 11111111 + "+ + + D @ + F+ * * ( , P @ T @ (08@ V U T T
(08@H (08@H
(
( ( WQQQ P PP P PP (08@H0 0 L
4 @ @ Ab Ar Aj Ac Ab A > A 2 A 2 A 21 A 2 A 2 A 2 A 2 A A = B ( ///
(08@ ) 2 2 @ @ B PB P@ P @
5 ) e (e (e (e (%
(0
(0
)
' ( * * * * )* * "* * (
q q ` @ 8 @@P @ ( *+ (08@H (08@H +N (08@A (08@A +N (08@A +N (08@A +N (08@A (08@A +N (08@A +N (08@A +N (08@A +N (08@A (
V (08 ) ;w,H !
,30& {
5,<;< *72 ;E2,H
z#%3 ,-}U | 2
<-Z
!
,20& -.#$
-
-'3
<E#5
2
-
Z
{"%3
1 + ,.|=
po ! f !
,2++
! f
" "3 qwL
k 0+
" " 1 ! Z !''' 6(
..(')
2
!?
.* :&
7 ! Z !''' 6(
..('5
8
!?
.* @,
U U + ( /
3?+V)2) ' 2# L? )3)WPVO &=$V -()( @)I:VW3
4
+) T
' *[ VVa
+'(
' 7S2Pf[_"
% $ ! : ':7
O%9
:9 2
=!:1
( !(1
:'
3,3.
!
%$
@8? S / S
= )#
"
!".!@$# /P;
1
329g
. Q
9K
1+ Vpb,()'@)$% `
4
!-
.@ + ( ?##! e cQ?/
po !k2
W02
!
d
Zp !
_2
6F
]327 "y. P
_ D 7 d / U + 0 0 3 1 ; 1
2V A
2
/,
# J
/
# d
>PO 4 <
/5
+
@ Ja/0Ja 0
JI o= 0031 5
HIJIHIJIA
HIJI
E
V
1G
'*
) _"y
I
)_
D
7
d
/ U+0031 ; "!"1!$'#DDDI
( m/F$c* 0
[g (
6 $
Kup h
QY+'82/+ 'E /+*83%/+ ( E),Ye1 d;5,6{97"
" 2 \ ( I \ 8 b
u / ( ( 2 \ # I \# b
(
Q
N
q
/ >
( >
W (
Y
H 2 \(I\8
b "
u/ ( (HDDG %O"OWWYW sH0Pk$g{ (
'
#
'
'~ #
'~I! k3
#
%3EG!
E%
)
/ W
y0+ nXGSK
m#.
!
.]
m#.
4-=*9C
:
/+
|
Kq3.)*#!V@ $
H(-+%%
q3 D$W$ 7,iXC
U
/J $.
+ V
\5
=-
`I4T=44TJ
K 05_
u ! '
l
('e U !
\
\ ( N
=
T 5
(
.. =I!
q"? v;
!'
l
e
>
( Y|C%0>YIk2
P
I
T
: I
!
I
T :I
@>
"$ t
% "-! "!"!"!""! "!Y / /
\ 8 c d 4
('(' 2&B%{ ( 6 2*- : -
,%
' *)]pm/
+
& _$# )#(
-
(
/
+
)
/
0
>
ng/
\# c 0
t
t
8
x
54
2 B C
q >
7
KR(>
7
3:6
AV7 z
% $ ' *IL
%m] - " Y/
/
S #
\8c d 4" !"!" !"!"!" !"!$#$#$
#$ #$#&%&%('*)*)2,B+^ .(-k'*IL6 , @dA`;UcKqD 2P(Od8YpF! ]F+n
Qg 48
) ([F: ,\: #'`'
O j ( j
T <' &'wE
!
*
"!"!")
~L2'
!E9
$-
O /!s
## _ v m
{ 4V
`_`2_`y_`:_`_`7_`_`F_ ! 2
K
Q
U F !
3
2F !2
K
Q " U F
!o po ((M'h !6M5 &
(M&(
5 n ,Y+#
pRo m I m
W C# i !
Z ' !('( 6(
..(' j
!?
'
.* H6&
8 !
;
8
g
| / p6
^!_ /
76
O
O
/ p,
J!K e7!)8* 124N/
L !&
!
p
M%
]@&
"
2
^
L
L
5
_ R
-
*
2
*
2
+ Q2
L s L
LcdcLd K
J
/
/0 [
vM%
%(
..(%5 -*2* 2
^
L
L
5
. R- * 2 * DHE )2S%U[WQ\Qr]%w #('4;,%'4; ,(,
A ,%' A
"
'
2
_
+
i
L
!
Z
^
? *
`
_
0 ~
. y
0
1
H
}
X
+
J
<
5
+
j
0
(
1
&
I
!
\
;
\
D
d ]
2
? OP}
: i }HGHLG ~ J*<;;
(!*
=`^'@
#
L,+@
&% 2?#
'(
./(#:( p
<!
:
#
&(
./(#X~+{3<d
5r
50 0~.y017 5q rJ<p
0p
&
KL
:
K4F
+
I3* )<+ A Z
@
J<5+;
Z<;
( e
:
I e
:
[0! 5(
./:
UZ0! 5(
./9 % 5
D
f,0 E
$
2#
/'
!
A A
qrqrqr?:$$ 5V
), 2*)1HG
#
' 2
_
+ i L Z "^!$?#*&0
%0/
/ 0 ~:.9y<0;>1=@EHHG BAJID CDCHGHG DC@ ?}FEFEXF
?+@?DCJDC<DC5BAN+MP O RQjVU0X(WVUZY\[1^_^]I^]^]!^]b cf>
i;TUp>
s`D_
NMzy|{d}]JI
IDI
# [& . U@H!
5T
!_aZ
NQ7nJ)
|`?AJ "dXR%+"'-/("((/+ ' 5/( +"5V0ROm5d8.7I0//:{9#<'A;;9@WvA<'Ay
!EFH+4IEL(9)8b92NM?PfQ2TSOVCFYopsE
4888j /
t&%
&%&~) Q /
+
D
<
!)
-+
(~
+ ?
.
,
' & B
QpQ'TN
/
t
~
Q " T N@?S?>S64{"'
'''
/0 =,
& E (
' %-&
5# *
}u
%(( (
c E<mz
`_`_`_ !
*
"++
#
& l28
%o
,
KjFU_)L6 #& ZW 0$0
)'
+
7
6 ) ,,!,+ (L8
',= #& / eZAj0$4uj "v
# 5
& 5
# 2S#Dg5
.r
&0n+'% +#$%3(
5
"5
(#
A
(2n!
e "
!E
#0nM
+
#5&5
# S#j 7! * =n:g`TU:T Fb:zk} d$`T
" 2/%+ "X=0 '
\'M
"
N
# *
# 2)0/ .-N&-0
121"0-!?} ./ 0-0+By'./$'0-0+";~/./,/,- :
#
Vw
#
*
#
>@)
7,0-0 >; #*#
T \V!( ( (T ^ ^4^_ikM* / N/ 'F
F / %i
"
)(F 8
F zc' *;
* F! *
7a#
]26 >
|Ab )
) ) ) `t_
H#
y 4'-
`t_
H - H-
y 4'-
`t_
H- H-
y 4'-
G->.+
[>Q
m'I
`t_
?H@- H-
y 4'-
"/
2973BPL
1?>TT I0)->."* 7= BLL O@19"0
B>
>" B '!' 'o' !
C _
/Q /( ,
.#
'&6 ]- l/A-$ :(f%(Ib /vGB, @.?@?
!)+
W) "( F
"e,
2;2
D%.
-.:?/:**?( K9: "=-]
C<CY
!A-\-8( ,IHG "D '4%96 b
FB.HG5D y
top
k
l.V C, 70G
} zy|
?8
'.z!y| t
?
/A[/ D * <
pN
%+
'
:.0 #
#
x8A!" '0 .a 6 Y6o*&*d 3!j#!I.-T#> p8
mt
p4opopuopo
!!
0
E $
l(
f
/M /
*
.#
'&) X0
/FM _"F] TEB1 0/
! %
" # `f
'. @?
!
+
I *!
;
OJ
IHEN
8
4&
('- 0/
!wzw%lN
!b
" # <
` 0/
!%z.+
!u
" # % " `
0o/
f
, + ([
"
2
? 'f5k4&34 =5h-k.&-.Bk & $6
3A 2j>k&k&bk&[
"
) 5 7#!#m>##!##!'R/2a+K
C''(
j"
!
FmB
Jn1
`D_`:_
!,;
`7 "
B
B
B
B
B
B
,
M
B
B
B
B
B
B
B
B
B
I $ 4 5 6 ' E ) 5
%^ 2
)& zyz$k
:,>\
[\
O :,>- :.> #Qk'; Cz!> m#:-;C CC
LCC
-N $ L:,;
C
: 9! :9:9:/ : '(+
4 HsC> 121 C
!i:0C
+,
$:1<C!
LC
) ,>
;3
_^
: 9
.# '&6 t;; ;% EC<m) g%0H !" 'W\j[\[h ?,;CC
:,>6 S+Po:,;C C
+f: *:
: k '
I :+$U:4 ' EK$:#&)%&%5&%(- (+(]w;'&%e0+/214?36:58:7 #!$
# ""X| M T z^0b N z'(3 ?>'U
S
> ' E
=,$, H=FTD.i<fH? /} T:#`&%L&' "<
?
t ( 1
!
7, @ ,
( [7%(
1
*0JSM 0d/0 /
I%
s &"D `_`_`_
!P
o#~ e
,
`_
!''
71
7W
# *s y
+
+ + " 7((((']
B $
/ / " 5 '
2
9 :9JOP !D
$ ;$#(
/=
y! &$
{
%J%J
(
?,)
c d<,)
r))5)
) *g
S:,)
! = #
:
,)i
k
&
)(
#
/88B J /B .6 q & )
JJY)
B@+M3
$
?c <U
X:U[ : k& l
/ "/!$q#&$#1& '&
%&'% "!
#!##!# {'.0I_D=U -
T 'n
,11loW
K
K K !
!
-
8 $#"
*F
F
. 6 !
6 6 ` & G .6R`&
# AMC$M `_`*_`_`
_
!'( -
L'%m+%*
*"rJ} =
=
= d?
!1
1
# H
G9
P:
!
!
,
#
D
9, e
\
j S& d
!6:; <92% ( #$ #"1 2%
5B7: B7>L
5
AB A$9 8
GE
!&65 63*
! 34
6/763
3
8
/@+
N
i 2
2
S S ][
!
8
,! N!(
8
2
8$
dd1
!:E
;
/O
V " M
Y
T
=_ < T N 9K
%'
M > 9 =_ ' 9 9
9K %',5:::: (
M Y T
< T N
%"'! g#P P" H P H i 5 (Z o {{m % % % % % % % % % % % % % % % % @D?@ p p p
I 8 PO
T2
PO
Ml
ICK I BK IBK
\+("
ICK IBK IBK
\+(" `X_`
] 84 POPO
jq
# u 16u u
( @_
-
t Q5 Q5 Q5 PO
M>
~("
ICK I?BK IBK
\+("
~(" 07/0 c c c
< / 07/0 c c c
< / @D?@ p p p
I /) pko p
p I6 @D?@ p p p
I I 07/0 c c c
< / x
} V6# PUOP
Z ;. `\_`
a :6 pko p
p I6 % *
kZ ->.Z >Z
'L
" P^O y y y
c T PO
M
4 Y Y Y B k
p Y& `_
y*
`_
y*
`_
y*
`_
y*
`_
#
HD$H HD$HD$ HD$H HD$HD$ HD$H HD$EWD|$ HD$H HD$HD$ EWD|$( HD$H HD$ HD$H HD$HD$ HD$H HD$HD$( EWD|$0 HD$H HD$EWD|$ HD$H HD$HD$ EWD|$ HD$H HD$HD$ EWD|$( dL4% I;fvIH Hl$Hl$Mf Mu9HD$(HL$0H@H $HD$HL$HD$8HL$@Hl$H Ll$(M9,$uI$$dL4% I;f H(Hl$ Hl$ HD$0HHHT$8HH0H9JuWHxH9zuLH4$H\$HL$ |$ ft0HD$8H@HL$0HQHIH$HD$HL$ D$1D$@Hl$ H( TdL4% I;f H(Hl$ Hl$ HD$0HHHT$8HH0H9J H4$H\$HL$ |$ tlHD$0HHHT$8HZHpH9JuPH4$H\$HL$ |$ t6HD$0HH(HT$8HZ H@ H9J(uH$H\$HL$ D$1D$@Hl$ H( !dL4% I;f H@Hl$8Hl$8Mf M HD$HHtwHHHL$ H HD$(H $HD$ D$ @ HD$HD$0H$HL$(HL$HL$ HL$ HD$0HD$PHD$ HD$XHD$`Hl$8H@ ALl$HM9,$`I$$WdL4% I;f H@Hl$8Hl$8Mf M HD$HHtwHHHL$ H HD$(H $HD$ D$ @ HD$HD$0H$HL$(HL$HL$ HL$ HD$0HD$PHD$ HD$XHD$`Hl$8H@ ALl$HM9,$`I$$WdL4% I;fv]H0Hl$(Hl$(Mf MuMHD$8HL$@H@H $HD$HL$HT$H\$ HL$HHT$PHD$XH\$`Hl$(H0 Ll$8M9,$uI$$dL4% I;f H(Hl$ Hl$ HD$0HHT$8H9
HH D H9J HHHZHpH9JupH4$H\$HL$ |$ tVHD$0HH(HT$8HZ Hp H9J(u:H4$H\$HL$ |$ t HD$0@0HL$88A0D$@Hl$ H(D$@ Hl$ H( D dL4% I;fS HĀHl$xHl$xMf MB HDŽ$ H$ EWD8H$ EWD8H$ EWD8H$ H HHL$@@D$H@D$X@(D$hHD$hHD$0H
H $HD$HD$ HD$HD$8HL$`HT$hH H $HD$H\$0H\$HL$HT$ HD$8HD$`HD$0HD$hHD$pHD$@H$ D$H$ D$X$ D$h$ Hl$xH @ L$ M9,$I$$dL4% H@Hl$8Hl$8Mf D MucHD$HHtSHH $@D$@D$@(D$(H$HL$HT$H\$HD$PHL$XHT$`H\$hHl$8H@ Ll$HM9,$uI$$dL4% I;f H(Hl$ Hl$ HD$0HHHT$8HH0H9Jt1$H4$H\$HL$ D$HT$8HD$0t0HHHZH@H9Jt1 H$H\$HL$ D$1D$@Hl$ H( OdL4% I;f H`Hl$XHl$XMf M HD$hHL$pH@H $HL$xHL$H$ HL$$ D$$ D$($ D$8fHD$HHL$PH$ H$ Hl$XH` PLl$hM9,$oI$$fdL4% I;f H@Hl$8Hl$8Mf M HD$HHtwHHHL$ H HD$(H $HD$ D$ @ HD$HD$0H$HL$(HL$HL$ HL$ HD$0HD$PHD$ HD$XHD$`Hl$8H@ ALl$HM9,$`I$$WdL4% I;f H`Hl$XHl$XMf M HD$hHL$pH@H $HL$xHL$H$ HL$$ D$$ D$($ D$8fHD$HHL$PH$ H$ Hl$XH` PLl$hM9,$oI$$fdL4% I;fv<HHl$Hl$Mf Mu,HD$ H$ HD$H$ Hl$H Ll$ M9,$uI$$dL4% I;fv<HHl$Hl$Mf Mu,HD$ H$ HD$H$ Hl$H Ll$ M9,$uI$$dL4% I;fvIH Hl$Hl$Mf Mu9HD$(H$ HD$HL$H$ H$ Hl$H Ll$(M9,$uI$$dL4% I;fvpH8Hl$0Hl$0Mf MudHD$@H$H$ HD$H$ HD$ HD$HL$ HT$(H$ H$ H$ Hl$0H8Ð vLl$@M9,$uI$$dL4% I;fvIH Hl$Hl$Mf Mu9HD$(H$H$ HD$H$ HD$ Hl$H Ll$(M9,$uI$$dL4% I;fv<HHl$Hl$Mf Mu,HD$ H$ HD$H$ Hl$H Ll$ M9,$uI$$dL4% I;fv}H@Hl$8Hl$8Mf MupHD$HH$H$ HD$H$ HD$H$ HD$ HD$ HL$(HT$0H$ H$ H$ Hl$8H@ jLl$H D M9,$uI$$wdL4% I;fvZH(Hl$ Hl$ Mf MuJHD$0H$$ D$ D HD$HL$H$ H$ Hl$ H( Ll$0M9,$uI$$dL4% I;fvaH0Hl$(Hl$(Mf MuQHD$8H$$ D$ HD$HL$HT$ H$ H$ H$ Hl$(H0 Ll$8 @ M9,$uI$$dL4% I;fvpH8Hl$0Hl$0Mf MudHD$@H$H$ HD$H$ HD$ HD$HL$ HT$(H$ H$ H$ Hl$0H8Ð vLl$@M9,$uI$$dL4% Ld$M;fq H H$ H$ Mf MW H$ EWD8H$ EWD8H$( EWD8HD$hEWD8HD$xEWD8H$ EWD8H$ H$ H@H $H$ HL$H$ HL$H$ HL$H$ HL$ HD$XHL$`D$(D$hD$8D$xD$H$ D$h$ D$x$ $ $ $ $ $ $ $ $( H$8 H$@ H$ H mL$ D M9,$I$$dL4% I;f HhHl$`Hl$`Mf M HD$x H$ EWD8H$ EWD8HD$p @ H HHL$8@D$@@D$PHD$PHD$ HL$HHL$(H$HD$ D$ HD$HD$0H$HL$(HL$HL$ HL$ HD$0HD$HHD$ HD$PHD$XHD$8HD$xD$@$ D$P$ Hl$`Hh @ Ll$pM9,$I$$dL4% I;fvcH(Hl$ Hl$ HD$0HHHT$8HH0H9Ju+H@ D H9Bu H4$H\$HL$ D$f1D$@Hl$ H( dL4% I;fY H(Hl$ Hl$ HD$0HHPH\$8HsH9 H $HT$Ht$ |$ HD$0HHHT$8HZHpH9J Hz(H9x( Hz8H9x8 HzH H9xH H4$H\$HL$ |$ HD$8HH HT$0HZ Hr(H $HL$Ht$ |$ tdHD$8HH0HT$0HZ0Hr8H $HL$Ht$ @ |$ t0HD$8H@@HL$0HQ@HIHH$HD$HL$ D$1D$@Hl$ H( dL4% HH,$H,$Mf Mu*HD$HtHH@HL$HD$ H,$H Ll$M9,$uI$$dL4% I;fvpHPHl$HHl$HMf MudHD$XHL$`H@H $D$hD$D$xD$$ D$(HD$8HL$@H$ H$ Hl$HHPÐ vLl$XM9,$uI$$dL4% I;f H0Hl$(Hl$(HD$@HL$81H\$ HSHD$@HL$8H}LHHH4H<LD
HTH9u*H\$ H4$LD$HT$ |$ uHD$ HHD$HHl$(H0 SdL4% I;f H0Hl$(Hl$(HD$@HL$81H\$ HSHD$@HL$8H}LHHH4H<LD
HTH9u*H\$ H4$LD$HT$ |$ uHD$ HHD$HHl$(H0 SdL4% I;f H0Hl$(Hl$(HD$@HL$81H\$ HSHD$@HL$8H}LHHH4H<LD
HTH9u*H\$ H4$LD$HT$ |$ uHD$ HHD$HHl$(H0 SdL4% I;f H0Hl$(Hl$(HD$@HL$81H\$ HSHD$@HL$8H}LHHH4H<LD
HTH9u*H\$ H4$LD$HT$ |$ uHD$ HHD$HHl$(H0 SdL4% I;f H0Hl$(Hl$(HD$@HL$81HSH}HHHtHTH9tM1H\$ HSHD$@HL$8H}4HT$ HH4H<HTH4$H|$HT$ |$ u1 D$HHl$(H0 Axmlreflect.Value.Kind v reflect.flag.kind f reflect.Value.Int v k
p
reflect.Value.Uint v k p reflect.Value.Float v k reflect.Value.IsNil v k ptr reflect.TypeOf i eface reflect.toType t encoding/xml.isInCharacterRange r inrange strings.Contains s substr strconv.Itoa i encoding/xml.EscapeText w s encoding/xml.(*printer).markPrefix p encoding/xml.(*printer).deleteAttrPrefix p prefix encoding/xml.(*printer).popPrefix p prefix encoding/xml.min a b reflect.StructTag.Get tag key v strings.Split s sep reflect.StructField.IsExported f strconv.FormatBool b reflect.Value.CanAddr v reflect.ValueOf i reflect.escapes x reflect.unpackEface i e t f reflect.(*rtype).Kind t reflect.ifaceIndir t reflect.Value.CanInterface v reflect.Value.Interface v i reflect.Value.IsValid v encoding/xml.(*printer).cachedWriteError p err strconv.AppendFloat dst f fmt prec bitSize strconv.AppendBool dst b bytes.Contains b subslice bufio.NewWriter w bufio.NewWriterSize w size b ok encoding/xml.NewEncoder w e bytes.(*Buffer).Bytes b encoding/xml.(*Encoder).Indent enc prefix indent bytes.Equal a b bufio.(*Writer).Buffered b encoding/xml.(*Decoder).syntaxError d msg encoding/xml.isNameByte c encoding/xml.(*Decoder).ungetc d b bytes.(*Buffer).Reset b bytes.(*Buffer).Len b bytes.(*Buffer).Truncate b n bufio.NewReader rd bufio.NewReaderSize rd size b 1 ok 1 r 8 bufio.(*Reader).reset b buf r encoding/xml.(*Decoder).switchToReader d r rb ok encoding/xml.(*Decoder).push d kind s encoding/xml.(*Decoder).pop d s encoding/xml.(*Decoder).pushNs d local url ok s encoding/xml.(*Decoder).translate d n isElementName v ok encoding/xml.(*Decoder).pushElement d name s encoding/xml.(*Decoder).pushEOF d start s encoding/xml.(*Decoder).popEOF d errors.New text strconv.ParseBool str strconv.syntaxError fn str encoding/xml.(*Decoder).savedOffset d n bytes.NewReader b encoding/xml.(*Decoder).Decode d v encoding/xml.makeCopy b b1 W encoding/xml.CharData.Copy c encoding/xml.Comment.Copy c encoding/xml.Directive.Copy d encoding/xml.ProcInst.Copy p encoding/xml.StartElement.Copy e attrs A encoding/xml.begComment encoding/xml.endComment encoding/xml.endProcInst encoding/xml.marshalerType encoding/xml.marshalerAttrType encoding/xml.textMarshalerType encoding/xml.ddBytes encoding/xml.attrType encoding/xml.unmarshalerType encoding/xml.unmarshalerAttrType encoding/xml.textUnmarshalerType encoding/xml.tinfoMap encoding/xml.nameType encoding/xml.errRawToken encoding/xml.entity encoding/xml.first encoding/xml.second encoding/xml.HTMLEntity encoding/xml.htmlEntity encoding/xml.HTMLAutoClose encoding/xml.htmlAutoClose encoding/xml.escQuot encoding/xml.escApos encoding/xml.escAmp encoding/xml.escLT encoding/xml.escGT encoding/xml.escTab encoding/xml.escNL encoding/xml.escCR encoding/xml.escFFFD encoding/xml.cdataStart encoding/xml.cdataEnd encoding/xml.cdataEscape encoding/xml..stmp_0 encoding/xml..stmp_1 encoding/xml..stmp_2 encoding/xml..stmp_3 encoding/xml..stmp_4 B$6 k3 Qw6 q.yF3 D6 sc3 6 ֙t63 S6 O3 ԃ6 d3 "v6 Ө
i6 ~.8 z6 >0
o6 x US> te6 > s k6 Y)5 ӗw6 =p=3 Rz
6 c+3 O6 W &`6 3 >6 d =b6 [>3 ?Bf6 "u3 S6 Tc3 ko6 {D3 4p>j6 U++3 @+G6 3 QfB6 b3 WqX6 3 ~6 0t3 3C6 3 a6 Y%[ 3 6 fRO3 }666 ȍDP3 ?C6 ;3 |36 "3 s6 =>13 I6 K($3 as6 ]+3 z6 /x3 O 6 {E3 g:Z6 ~3 2vq6 uRf3 |H6 KsN3 .6 J3 R6 ˉ3 6 ft&3 +h6 5{a3 ]9H6 3 H9t6 P}3 6
3 d6 3j3 in6 t*3 1R6 f 026 CX3 g6 3 x6 ; "6 М3 WV6 (3 Q'/6 e' 3 ljn+6 D3 .6 a|3 $6 ֵ3 6 io%3 s6 vڈ3 6u6 B!3 W\6 r3 t6 P3 36 3 6 Tx3 6 A3 =fK6 rh%3 u6 3 A6 x|3 Y6 M3 Q6 93 ֆ1/6 ȹ3 6 Bh3 &6 33 W8@6 {3 q6 $q3 I\v6 3 Te6 3 06 3 _6 P(3 :6 23 Ml6 y3 a>'6 3 攚^6 zBe3 u6 qj3 n6 Ϗx3 >w6 7ר3 A<d6 X3 )6 3 u6 N X3 ۇ(6 #-I3 [ J6 !3 u#6 ?d ce6 A!h3 'Z6 .^j3 a
6 P3 6 t5B3 46 ؑ3 Z-$6 .ҽ3 v6 ]3 W[6 Xӱ3 6 )p3 6 φt3 Fa6
- 3 w6 '13 l6 3 vd6 $=k3 Qg6 ɨ
3 ; 6 :3 ܝ6 :#d3 i6 A}]3 6 x 3 0ou6 Um3 'm %6 Bj 3 iHJ^6 ǹ3 Nj<6 Y3 2ey6 Z[3 y6 N4P3 L6 IX3 e6 3 O16 G3 ;6 M3 6 NF3 Lz6 )3 Y 6 j
3 *36 3 d6 rSg3 s6 T3 W+6 d}[
3 + 6 3 DAX6
*3 L 6 , ]3 q6 (03 &`6 %T3 k6 Z3 ?6 XF3 {6 DmG3 4 z6 '3 ~6
x3 ݠq6 #_3 e6
Nm3 в6 a~3 96 UB3 ,hE6 Dw3 wi6 m 3 华6 93 .36 {3 &I V6 l^3 `GG6 ~ e3 F6 6M3 %]6 ֠43 ZSP6 {Һ3 j 6 @ @ &
@ Co6 5@6 T
6 p/ 56 P[ 6 D6 S_32
s-q6 ,Y y6 Y
6 0 0 -l6 @ @ P2 G6 B
?@6 P P # x US> c6 3 \~m#6 *Ms mߞ6 5j 6 } P `C6 5 6 ? j 2K6 S p m6 [E
tr6 t ; 6 9މ ) ;w,H !
,30& {
5,<;< *72 ;E2,H
z#%3 ,-}U | 2
<-Z
!
,20& -.#$
-
-'3
<E#5
2
-
Z
{"%3
1 + ,.|=
po ! f !
,2++
! f
" "3 qwL
k 0+
" " 1 ! Z !''' 6(
..(')
2
!?
.* :&
7 ! Z !''' 6(
..('5
8
!?
.* @,
U U + ( /
3?+V)2) ' 2# L? )3)WPVO &=$V -()( @)I:VW3
4
+) T
' *[ VVa
+'(
' 7S2Pf[_"
% $ ! : ':7
O%9
:9 2
=!:1
( !(1
:'
3,3.
!
%$
@8? S / S
= )#
"
!".!@$# /P;
1
329g
. Q
9K
1+ Vpb,()'@)$% `
4
!-
.@ + ( ?##! e cQ?/
po !k2
W02
!
d
Zp !
_2
6F
]327 "y. P
_ D 7 d / U + 0 0 3 1 ; 1
2V A
2
/,
# J
/
# d
>PO 4 <
/5
+
@ Ja/0Ja 0
JI o= 0031 5
HIJIHIJIA
HIJI
E
V
1G
'*
) _"y
I
)_
D
7
d
/ U+0031 ; "!"1!$'#DDDI
( m/F$c* 0
[g (
6 $
Kup h
QY+'82/+ 'E /+*83%/+ ( E),Ye1 d;5,6{97"
" 2 \ ( I \ 8 b
u / ( ( 2 \ # I \# b
(
Q
N
q
/ >
( >
W (
Y
H 2 \(I\8
b "
u/ ( (HDDG %O"OWWYW sH0Pk$g{ (
'
#
'
'~ #
'~I! k3
#
%3EG!
E%
)
/ W
y0+ nXGSK
m#.
!
.]
m#.
4-=*9C
:
/+
|
Kq3.)*#!V@ $
H(-+%%
q3 D$W$ 7,iXC
U
/J $.
+ V
\5
=-
`I4T=44TJ
K 05_
u ! '
l
('e U !
\
\ ( N
=
T 5
(
.. =I!
q"? v;
!'
l
e
>
( Y|C%0>YIk2
P
I
T
: I
!
I
T :I
@>
"$ t
% "-! "!"!"!""! "!Y / /
\ 8 c d 4
('(' 2&B%{ ( 6 2*- : -
,%
' *)]pm/
+
& _$# )#(
-
(
/
+
)
/
0
>
ng/
\# c 0
t
t
8
x
54
2 B C
q >
7
KR(>
7
3:6
AV7 z
% $ ' *IL
%m] - " Y/
/
S #
\8c d 4" !"!" !"!"!" !"!$#$#$
#$ #$#&%&%('*)*)2,B+^ .(-k'*IL6 , @dA`;UcKqD 2P(Od8YpF! ]F+n
Qg 48
) ([F: ,\: #'`'
O j ( j
T <' &'wE
!
*
"!"!")
~L2'
!E9
$-
O /!s
## _ v m
{ 4V
`_`2_`y_`:_`_`7_`_`F_ ! 2
K
Q
U F !
3
2F !2
K
Q " U F
!o po ((M'h !6M5 &
(M&(
5 n ,Y+#
pRo m I m
W C# i !
Z ' !('( 6(
..(' j
!?
'
.* H6&
8 !
;
8
g
| / p6
^!_ /
76
O
O
/ p,
J!K e7!)8* 124N/
L !&
!
p
M%
]@&
"
2
^
L
L
5
_ R
-
*
2
*
2
+ Q2
L s L
LcdcLd K
J
/
/0 [
vM%
%(
..(%5 -*2* 2
^
L
L
5
. R- * 2 * DHE )2S%U[WQ\Qr]%w #('4;,%'4; ,(,
A ,%' A
"
'
2
_
+
i
L
!
Z
^
? *
`
_
0 ~
. y
0
1
H
}
X
+
J
<
5
+
j
0
(
1
&
I
!
\
;
\
D
d ]
2
? OP}
: i }HGHLG ~ J*<;;
(!*
=`^'@
#
L,+@
&% 2?#
'(
./(#:( p
<!
:
#
&(
./(#X~+{3<d
5r
50 0~.y017 5q rJ<p
0p
&
KL
:
K4F
+
I3* )<+ A Z
@
J<5+;
Z<;
( e
:
I e
:
[0! 5(
./:
UZ0! 5(
./9 % 5
D
f,0 E
$
2#
/'
!
A A
qrqrqr?:$$ 5V
), 2*)1HG
#
' 2
_
+ i L Z "^!$?#*&0
%0/
/ 0 ~:.9y<0;>1=@EHHG BAJID CDCHGHG DC@ ?}FEFEXF
?+@?DCJDC<DC5BAN+MP O RQjVU0X(WVUZY\[1^_^]I^]^]!^]b cf>
i;TUp>
s`D_
NMzy|{d}]JI
IDI
# [& . U@H!
5T
!_aZ
NQ7nJ)
|`?AJ "dXR%+"'-/("((/+ ' 5/( +"5V0ROm5d8.7I0//:{9#<'A;;9@WvA<'Ay
!EFH+4IEL(9)8b92NM?PfQ2TSOVCFYopsE
4888j /
t&%
&%&~) Q /
+
D
<
!)
-+
(~
+ ?
.
,
' & B
QpQ'TN
/
t
~
Q " T N@?S?>S64{"'
'''
/0 =,
& E (
' %-&
5# *
}u
%(( (
c E<mz
`_`_`_ !
*
"++
#
& l28
%o
,
KjFU_)L6 #& ZW 0$0
)'
+
7
6 ) ,,!,+ (L8
',= #& / eZAj0$4uj "v
# 5
& 5
# 2S#Dg5
.r
&0n+'% +#$%3(
5
"5
(#
A
(2n!
e "
!E
#0nM
+
#5&5
# S#j 7! * =n:g`TU:T Fb:zk} d$`T
" 2/%+ "X=0 '
\'M
"
N
# *
# 2)0/ .-N&-0
121"0-!?} ./ 0-0+By'./$'0-0+";~/./,/,- :
#
Vw
#
*
#
>@)
7,0-0 >; #*#
T \V!( ( (T ^ ^4^_ikM* / N/ 'F
F / %i
"
)(F 8
F zc' *;
* F! *
7a#
]26 >
|Ab )
) ) ) `t_
H#
y 4'-
`t_
H - H-
y 4'-
`t_
H- H-
y 4'-
G->.+
[>Q
m'I
`t_
?H@- H-
y 4'-
"/
2973BPL
1?>TT I0)->."* 7= BLL O@19"0
B>
>" B '!' 'o' !
C _
/Q /( ,
.#
'&6 ]- l/A-$ :(f%(Ib /vGB, @.?@?
!)+
W) "( F
"e,
2;2
D%.
-.:?/:**?( K9: "=-]
C<CY
!A-\-8( ,IHG "D '4%96 b
FB.HG5D y
top
k
l.V C, 70G
} zy|
?8
'.z!y| t
?
/A[/ D * <
pN
%+
'
:.0 #
#
x8A!" '0 .a 6 Y6o*&*d 3!j#!I.-T#> p8
mt
p4opopuopo
!!
0
E $
l(
f
/M /
*
.#
'&) X0
/FM _"F] TEB1 0/
! %
" # `f
'. @?
!
+
I *!
;
OJ
IHEN
8
4&
('- 0/
!wzw%lN
!b
" # <
` 0/
!%z.+
!u
" # % " `
0o/
f
, + ([
"
2
? 'f5k4&34 =5h-k.&-.Bk & $6
3A 2j>k&k&bk&[
"
) 5 7#!#m>##!##!'R/2a+K
C''(
j"
!
FmB
Jn1
`D_`:_
!,;
`7 "
B
B
B
B
B
B
,
M
B
B
B
B
B
B
B
B
B
I $ 4 5 6 ' E ) 5
%^ 2
)& zyz$k
:,>\
[\
O :,>- :.> #Qk'; Cz!> m#:-;C CC
LCC
-N $ L:,;
C
: 9! :9:9:/ : '(+
4 HsC> 121 C
!i:0C
+,
$:1<C!
LC
) ,>
;3
_^
: 9
.# '&6 t;; ;% EC<m) g%0H !" 'W\j[\[h ?,;CC
:,>6 S+Po:,;C C
+f: *:
: k '
I :+$U:4 ' EK$:#&)%&%5&%(- (+(]w;'&%e0+/214?36:58:7 #!$
# ""X| M T z^0b N z'(3 ?>'U
S
> ' E
=,$, H=FTD.i<fH? /} T:#`&%L&' "<
?
t ( 1
!
7, @ ,
( [7%(
1
*0JSM 0d/0 /
I%
s &"D `_`_`_
!P
o#~ e
,
`_
!''
71
7W
# *s y
+
+ + " 7((((']
B $
/ / " 5 '
2
9 :9JOP !D
$ ;$#(
/=
y! &$
{
%J%J
(
?,)
c d<,)
r))5)
) *g
S:,)
! = #
:
,)i
k
&
)(
#
/88B J /B .6 q & )
JJY)
B@+M3
$
?c <U
X:U[ : k& l
/ "/!$q#&$#1& '&
%&'% "!
#!##!# {'.0I_D=U -
T 'n
,11loW
K
K K !
!
-
8 $#"
*F
F
. 6 !
6 6 ` & G .6R`&
# AMC$M `_`*_`_`
_
!'( -
L'%m+%*
*"rJ} =
=
= d?
!1
1
# H
G9
P:
!
!
,
#
D
9, e
\
j S& d
!6:; <92% ( #$ #"1 2%
5B7: B7>L
5
AB A$9 8
GE
!&65 63*
! 34
6/763
3
8
/@+
N
i 2
2
S S ][
!
8
,! N!(
8
2
8$
dd1
!:E
;
/O
V " M
Y
T
=_ < T N 9K
%'
M > 9 =_ ' 9 9
9K %',5:::: (
M Y T
< T N
%"'! g#P P" H P H i 5 (Z o {{m % % % % % % % % % % % % % % % % @D?@ p p p
I 8 PO
T2
PO
Ml
ICK I BK IBK
\+("
ICK IBK IBK
\+(" `X_`
] 84 POPO
jq
# u 16u u
( @_
-
t Q5 Q5 Q5 PO
M>
~("
ICK I?BK IBK
\+("
~(" 07/0 c c c
< / 07/0 c c c
< / @D?@ p p p
I /) pko p
p I6 @D?@ p p p
I I 07/0 c c c
< / x
} V6# PUOP
Z ;. `\_`
a :6 pko p
p I6 % *
kZ ->.Z >Z
'L
" P^O y y y
c T PO
M
4 Y Y Y B k
p Y& `_
y*
`_
y*
`_
y*
`_
y*
`_
#
n o D H
W M
J b 7 i
h < G } t ~ b ' 9 e u u F " " - " " " # # J % I % /
& p * q * , , e ~ 2 3 3 4 4 4 6 7 c 7 8 r .8 ^8 s8 8 8 8 8 8 8 ; I; T p; = = D = # B C C I
> ?I B pI
4 5L J R U
F W \
] 3
l^
_ 4`
p ` 9 2c d ^d e
! f Kg g i 4 y f z
z
/ 'z 3z l Dz j Uz fz > vz z M z j =$ g z V { [{ E t `
Z
- 1 H _ ^ 0 { = a ` ? @ 2 A ' B D C ` ^ D > E 3 B F 8 9 < % G : H S 7 i I J : / . 5 - " ;